KEGG   Rubrivivax gelatinosus: RGE_07440Help
Entry
RGE_07440         CDS       T01803                                 

Definition
6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_07440
   01230 Biosynthesis of amino acids
    RGE_07440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_07440
   00030 Pentose phosphate pathway
    RGE_07440
   00051 Fructose and mannose metabolism
    RGE_07440
   00052 Galactose metabolism
    RGE_07440
  Energy metabolism
   00680 Methane metabolism
    RGE_07440
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RGE_07440
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RGE_07440
Protein phosphatases and associated proteins [BR:rge01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RGE_07440
Messenger RNA biogenesis [BR:rge03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RGE_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772778..773995
Genome map
AA seq 405 aa AA seqDB search
MSSGKILVAQGGGPTAVINQSLVGVVLEARRFRDVRLVYGARHGVRGIVDEDFVDLTQET
SHNLEQVANTPSSALGSTRDKPDLKYCQEIFKVLQAHEIEHFFYIGGNDSSDTVRIVSEQ
AIKAGYPLRAIHIPKTIDNDLVGSDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERVFDIGQFLRDVKTMYERHGRCVIAVSEGIH
DASGTPIVVQLAKAVEHDAHGNVQLSGNGALADLLCEEIKSKLKIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGKSDGSVAIKRTGFYSVDYELLPLAAVAGKTRTMD
DEFITAEGTDVTDAFRMYLRPLLGSRMPDAYRLRPAPVPKVLRTP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaggcaagattctcgtggcccagggtggggggccgaccgcagtcatcaaccag
tcgctcgtcggcgtcgtgctcgaggcgcggcgctttcgcgacgtgcgcctggtctacggc
gcgcgccacggcgtgcgcggcatcgtcgacgaggacttcgtcgacctgacgcaggaaacc
agccacaacctcgagcaggtcgccaacacgccgtcgtcggcgctgggctcgacgcgcgac
aagcccgacctgaagtactgccaggagatcttcaaggtcctgcaggcgcacgagatcgag
cacttcttctacatcggcggcaacgactcgtcggacacggtgcgcatcgtcagcgagcag
gcgatcaaggccggctacccgctgcgcgcgatccacatcccgaagacgatcgacaacgac
ctcgtcggcagcgaccacacgcccggcttcccgagcgcggcgcgtttcgtcgcccaggcc
ttcgccggcgccaacctcgacaacgcggcgctgccgggcgtctacgtcggcgtcgtgatg
ggccgccacgccggcttcctgaccgccgccagcgcgctgggcaagaagttccccgacgac
ggcccgcacctgatctacctgcccgagcgtgtcttcgacatcggccagttcctgcgcgac
gtgaagacgatgtacgagcgccacggccgctgcgtcatcgccgtcagcgaaggcatccac
gacgcctcgggcacgccgatcgtcgtgcagctggccaaggccgtcgagcacgacgcgcac
ggcaacgtgcagctctcgggcaacggcgcgctggccgacctgctgtgcgaggagatcaag
tccaagctgaagatcaagcgcgtgcgcggcgacaccttcggctacctgcagaggagcttc
atcggctgcgtcagcgacgtcgaccagcgcgaggcgcgcgaagtcggcgagaaggccgtg
cagttcgcgatgtggggcaagagcgacggctcggtggcgatcaagcgcaccggcttctac
tcggtcgactacgagctgctgccgctggccgcggtggccggcaagacgcgcacgatggac
gacgagttcatcaccgccgaaggcaccgacgtcaccgacgccttccgcatgtatctgcgg
ccgctgctgggctcgcgcatgcccgatgcctaccggctgcggccggctcccgttcccaag
gtgctgaggaccccatga

DBGET integrated database retrieval system