KEGG   Rubrivivax gelatinosus: RGE_07440Help
Entry
RGE_07440         CDS       T01803                                 

Definition
6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rge01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rge01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rge00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rge00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rge00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rge00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rge00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772778..773995
Genome map
AA seq 405 aa AA seqDB search
MSSGKILVAQGGGPTAVINQSLVGVVLEARRFRDVRLVYGARHGVRGIVDEDFVDLTQET
SHNLEQVANTPSSALGSTRDKPDLKYCQEIFKVLQAHEIEHFFYIGGNDSSDTVRIVSEQ
AIKAGYPLRAIHIPKTIDNDLVGSDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERVFDIGQFLRDVKTMYERHGRCVIAVSEGIH
DASGTPIVVQLAKAVEHDAHGNVQLSGNGALADLLCEEIKSKLKIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGKSDGSVAIKRTGFYSVDYELLPLAAVAGKTRTMD
DEFITAEGTDVTDAFRMYLRPLLGSRMPDAYRLRPAPVPKVLRTP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaggcaagattctcgtggcccagggtggggggccgaccgcagtcatcaaccag
tcgctcgtcggcgtcgtgctcgaggcgcggcgctttcgcgacgtgcgcctggtctacggc
gcgcgccacggcgtgcgcggcatcgtcgacgaggacttcgtcgacctgacgcaggaaacc
agccacaacctcgagcaggtcgccaacacgccgtcgtcggcgctgggctcgacgcgcgac
aagcccgacctgaagtactgccaggagatcttcaaggtcctgcaggcgcacgagatcgag
cacttcttctacatcggcggcaacgactcgtcggacacggtgcgcatcgtcagcgagcag
gcgatcaaggccggctacccgctgcgcgcgatccacatcccgaagacgatcgacaacgac
ctcgtcggcagcgaccacacgcccggcttcccgagcgcggcgcgtttcgtcgcccaggcc
ttcgccggcgccaacctcgacaacgcggcgctgccgggcgtctacgtcggcgtcgtgatg
ggccgccacgccggcttcctgaccgccgccagcgcgctgggcaagaagttccccgacgac
ggcccgcacctgatctacctgcccgagcgtgtcttcgacatcggccagttcctgcgcgac
gtgaagacgatgtacgagcgccacggccgctgcgtcatcgccgtcagcgaaggcatccac
gacgcctcgggcacgccgatcgtcgtgcagctggccaaggccgtcgagcacgacgcgcac
ggcaacgtgcagctctcgggcaacggcgcgctggccgacctgctgtgcgaggagatcaag
tccaagctgaagatcaagcgcgtgcgcggcgacaccttcggctacctgcagaggagcttc
atcggctgcgtcagcgacgtcgaccagcgcgaggcgcgcgaagtcggcgagaaggccgtg
cagttcgcgatgtggggcaagagcgacggctcggtggcgatcaagcgcaccggcttctac
tcggtcgactacgagctgctgccgctggccgcggtggccggcaagacgcgcacgatggac
gacgagttcatcaccgccgaaggcaccgacgtcaccgacgccttccgcatgtatctgcgg
ccgctgctgggctcgcgcatgcccgatgcctaccggctgcggccggctcccgttcccaag
gtgctgaggaccccatga

DBGET integrated database retrieval system