KEGG   Rubrivivax gelatinosus: RGE_07440Help
Entry
RGE_07440         CDS       T01803                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00010  Glycolysis / Gluconeogenesis
rge00030  Pentose phosphate pathway
rge00051  Fructose and mannose metabolism
rge00052  Galactose metabolism
rge00680  Methane metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_07440
   00030 Pentose phosphate pathway
    RGE_07440
   00051 Fructose and mannose metabolism
    RGE_07440
   00052 Galactose metabolism
    RGE_07440
  Energy metabolism
   00680 Methane metabolism
    RGE_07440
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RGE_07440
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RGE_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAL94087
UniProt: I0HM50
Position
772778..773995
Genome map
AA seq 405 aa AA seqDB search
MSSGKILVAQGGGPTAVINQSLVGVVLEARRFRDVRLVYGARHGVRGIVDEDFVDLTQET
SHNLEQVANTPSSALGSTRDKPDLKYCQEIFKVLQAHEIEHFFYIGGNDSSDTVRIVSEQ
AIKAGYPLRAIHIPKTIDNDLVGSDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERVFDIGQFLRDVKTMYERHGRCVIAVSEGIH
DASGTPIVVQLAKAVEHDAHGNVQLSGNGALADLLCEEIKSKLKIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGKSDGSVAIKRTGFYSVDYELLPLAAVAGKTRTMD
DEFITAEGTDVTDAFRMYLRPLLGSRMPDAYRLRPAPVPKVLRTP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaggcaagattctcgtggcccagggtggggggccgaccgcagtcatcaaccag
tcgctcgtcggcgtcgtgctcgaggcgcggcgctttcgcgacgtgcgcctggtctacggc
gcgcgccacggcgtgcgcggcatcgtcgacgaggacttcgtcgacctgacgcaggaaacc
agccacaacctcgagcaggtcgccaacacgccgtcgtcggcgctgggctcgacgcgcgac
aagcccgacctgaagtactgccaggagatcttcaaggtcctgcaggcgcacgagatcgag
cacttcttctacatcggcggcaacgactcgtcggacacggtgcgcatcgtcagcgagcag
gcgatcaaggccggctacccgctgcgcgcgatccacatcccgaagacgatcgacaacgac
ctcgtcggcagcgaccacacgcccggcttcccgagcgcggcgcgtttcgtcgcccaggcc
ttcgccggcgccaacctcgacaacgcggcgctgccgggcgtctacgtcggcgtcgtgatg
ggccgccacgccggcttcctgaccgccgccagcgcgctgggcaagaagttccccgacgac
ggcccgcacctgatctacctgcccgagcgtgtcttcgacatcggccagttcctgcgcgac
gtgaagacgatgtacgagcgccacggccgctgcgtcatcgccgtcagcgaaggcatccac
gacgcctcgggcacgccgatcgtcgtgcagctggccaaggccgtcgagcacgacgcgcac
ggcaacgtgcagctctcgggcaacggcgcgctggccgacctgctgtgcgaggagatcaag
tccaagctgaagatcaagcgcgtgcgcggcgacaccttcggctacctgcagaggagcttc
atcggctgcgtcagcgacgtcgaccagcgcgaggcgcgcgaagtcggcgagaaggccgtg
cagttcgcgatgtggggcaagagcgacggctcggtggcgatcaagcgcaccggcttctac
tcggtcgactacgagctgctgccgctggccgcggtggccggcaagacgcgcacgatggac
gacgagttcatcaccgccgaaggcaccgacgtcaccgacgccttccgcatgtatctgcgg
ccgctgctgggctcgcgcatgcccgatgcctaccggctgcggccggctcccgttcccaag
gtgctgaggaccccatga

DBGET integrated database retrieval system