KEGG   Rubrivivax gelatinosus: RGE_08570Help
Entry
RGE_08570         CDS       T01803                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rge  Rubrivivax gelatinosus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RGE_08570 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RGE_08570 (murA)
Enzymes [BR:rge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     RGE_08570 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891190..892455
Genome map
AA seq 421 aa AA seqDB search
MDKLLIRGGRRLQGEVSISGAKNAALPELCAALLCAEPLTLDNVPRLQDVATMLSLLRRM
GVAVERPEDQPARVTLAAPDSLDPVAPYELVKTMRASILVLGPLLARFGRATVSLPGGCA
IGSRPVDQHIKGLQAMGATVKVEHGNIVASAGRLRGARITTDMITVTGTENLLMAAALAE
GETVLENAAQEPEVTDLAELLIAMGAKIEGHGSGRIRIQGVERLHAPAAPHRIVPDRIEA
GTFLCAVAAAGGEAVLRDARAEHLDAVITKLREAGVAIESGEDWIRVRADARPKAVSFRT
SEYPAFPTDMQAQFMAVDCVAEGAAKVAETIFENRFMHVNELVRLGARIQVDGHTAMIQG
VDTLSGATVMATDLRASASLVIAGLVAEGETTVERIYHLDRGYDRMEAKLRALGADIERV
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcctgatccgcggcggccgccgcctccaaggcgaggtgtcgatttccggc
gccaagaacgccgcgctgcccgaactctgcgccgcgctgctgtgcgccgagccgctgacg
ctggacaacgtgccgcgcctgcaggacgtggcgacgatgctgtcgctgctgcgccgcatg
ggcgtcgccgtcgagcgccccgaagaccagccggctcgcgtgacgctcgccgcgcccgac
agcctggacccggtcgcgccctacgagctcgtgaagacgatgcgcgcgtcgatcctcgtg
ctcggcccgttgctggcgcgtttcggccgcgcgacggtgtcgctgcccggcggctgcgct
atcggctcgcgcccggtcgaccagcacatcaagggcctgcaggcgatgggcgcgacggtc
aaggtcgagcacggcaacatcgtcgccagcgccggccgcctgcgcggcgcgcgcatcacg
accgacatgatcaccgtcaccggcaccgagaacctgctgatggccgcggcgctggccgaa
ggcgagacggtgctggagaacgccgcccaggagcccgaggtcaccgacctggccgagctg
ctgatcgcgatgggcgcgaagatcgaaggccacggcagcggccgcatccgcatccagggt
gtcgagcgcctgcacgcgccggccgcgccgcaccgcatcgtgcccgaccgcatcgaagcc
ggcaccttcctctgcgcggtggccgccgctggcggcgaggccgtgctgcgcgatgcgcgt
gccgagcacctggacgccgtcatcaccaagctgcgcgaggccggcgtcgccatcgagtcg
ggcgaggactggatccgcgtgcgcgccgatgcccgcccgaaggcggtgagctttcgcacc
agcgagtacccggccttcccgaccgacatgcaggcccagttcatggccgtcgactgcgtc
gccgaaggtgccgccaaggtcgcggagacgatcttcgagaaccgcttcatgcacgtcaac
gagctggtgcgcctgggcgcacgcatccaggtcgacggccacacggcgatgatccagggc
gtcgacacgctctccggcgccaccgtgatggcgaccgacctgcgcgcctcggccagcctg
gtcatcgccggcctggtggccgaaggcgagaccacggtggagcgcatctaccatctggac
cgcggctacgaccgcatggaagccaagctgcgcgccctgggcgccgacatcgagcgcgtc
cgatga

DBGET integrated database retrieval system