KEGG   Rubrivivax gelatinosus: RGE_08590Help
Entry
RGE_08590         CDS       T01803                                 

Gene name
hisD
Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rge  Rubrivivax gelatinosus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rge01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rge00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893090..894409
Genome map
AA seq 439 aa AA seqDB search
MSPVAITRLSTADAGFEAGFQRVLHWSAETDAEIENRVAAILDDVRQRGDAAVLEYTARF
DRLQAASVAALEISADELRGALAAITPAQRSALEAAAERVRDYHQRQLQACGQSWSYRDA
DGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAQVAGVGEIVMVVPTPGGERNALV
LAAASVAGAHRVFTIGGAQAVAALAYGTATVPRVDKITGPGNAYVASAKRRVFGQVGIDM
IAGPSEILVLADGTTPADWVAMDLFSQAEHDELAQSILLSPDAGYIAAVQAEIERLLPAM
PRQATIRASLEGRGALIHTRSMEEACEIANRVAPEHLEVSSAEPGRWEPLLRHAGAIFLG
AFTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEAGAQVLGPIAAELA
YGEGLQAHAQAAEFRLKPR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgtcgccatcacccgcctgtccaccgccgacgccggcttcgaggccggcttc
cagcgtgtgctgcactggtcggccgagaccgatgccgagatcgagaaccgcgtcgctgcg
atcctcgacgacgtgcgccagcgcggcgacgccgctgtgctggagtacacggcacgtttc
gaccgcctgcaggccgcttcggtcgccgcgctggagatcagcgccgacgaactgcgcggc
gcattggccgcgatcacgccggcgcagcgctcggcgctcgaagccgccgccgaacgggtg
cgcgactaccaccagcgccagctccaggcctgcggccagagctggagctaccgcgacgcc
gacggcacgctgctgggccagaaggtcacgccgctggaccgcgtcggcatctacgtgccc
ggcggcaaggcggcctacccgtcgagcgtgctgatgaacgcgatcccggcccaggtggcc
ggtgtcggcgagatcgtgatggtcgtgccgacgcccggcggcgagcgcaacgcgctggtg
ctggccgccgcctcggtggccggcgcgcaccgcgtgttcacgatcggcggcgcccaggcg
gtggccgcgctggcctacggcacggccaccgtgccgcgtgtcgacaagatcaccggcccg
ggcaacgcctacgtcgccagcgccaaacgccgggtcttcggccaggtcggcatcgacatg
atcgccgggccgagcgagatcctggtgctggccgacggcacgacgccggccgactgggtg
gcgatggacctgttcagccaagccgaacacgacgaactggcgcagagcatcctgctcagc
cccgacgccggctacatcgccgcggtgcaggccgagatcgagcgcctgctgccggcgatg
ccgcgccaggcgacgatccgcgcctcgctcgaaggccgcggcgcgctgatccacacgcgt
tcgatggaagaagcctgcgagatcgccaaccgcgtcgcgcccgagcacctggaagtcagc
tcggccgaacccggccgctgggagccgctgctgcgccacgccggcgcgatcttcctcggc
gccttcaccagcgagagcctgggcgactactgcgccgggcccaaccacgtgctgccgacc
tcgggcaccgcgcgcttctcgtcgccgctgggcgtctacgatttccagaagcgcagcagc
ctgatcgaggtgagcgaagccggcgcccaggtgctgggcccgatcgccgccgagctggcc
tacggcgaagggctgcaggcccacgcccaggccgccgagttccgtctgaagccccgttga

DBGET integrated database retrieval system