KEGG   Rubrivivax gelatinosus: RGE_08590Help
Entry
RGE_08590         CDS       T01803                                 

Gene name
hisD
Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rge  Rubrivivax gelatinosus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_08590 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RGE_08590 (hisD)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RGE_08590 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893090..894409
Genome map
AA seq 439 aa AA seqDB search
MSPVAITRLSTADAGFEAGFQRVLHWSAETDAEIENRVAAILDDVRQRGDAAVLEYTARF
DRLQAASVAALEISADELRGALAAITPAQRSALEAAAERVRDYHQRQLQACGQSWSYRDA
DGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAQVAGVGEIVMVVPTPGGERNALV
LAAASVAGAHRVFTIGGAQAVAALAYGTATVPRVDKITGPGNAYVASAKRRVFGQVGIDM
IAGPSEILVLADGTTPADWVAMDLFSQAEHDELAQSILLSPDAGYIAAVQAEIERLLPAM
PRQATIRASLEGRGALIHTRSMEEACEIANRVAPEHLEVSSAEPGRWEPLLRHAGAIFLG
AFTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEAGAQVLGPIAAELA
YGEGLQAHAQAAEFRLKPR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgtcgccatcacccgcctgtccaccgccgacgccggcttcgaggccggcttc
cagcgtgtgctgcactggtcggccgagaccgatgccgagatcgagaaccgcgtcgctgcg
atcctcgacgacgtgcgccagcgcggcgacgccgctgtgctggagtacacggcacgtttc
gaccgcctgcaggccgcttcggtcgccgcgctggagatcagcgccgacgaactgcgcggc
gcattggccgcgatcacgccggcgcagcgctcggcgctcgaagccgccgccgaacgggtg
cgcgactaccaccagcgccagctccaggcctgcggccagagctggagctaccgcgacgcc
gacggcacgctgctgggccagaaggtcacgccgctggaccgcgtcggcatctacgtgccc
ggcggcaaggcggcctacccgtcgagcgtgctgatgaacgcgatcccggcccaggtggcc
ggtgtcggcgagatcgtgatggtcgtgccgacgcccggcggcgagcgcaacgcgctggtg
ctggccgccgcctcggtggccggcgcgcaccgcgtgttcacgatcggcggcgcccaggcg
gtggccgcgctggcctacggcacggccaccgtgccgcgtgtcgacaagatcaccggcccg
ggcaacgcctacgtcgccagcgccaaacgccgggtcttcggccaggtcggcatcgacatg
atcgccgggccgagcgagatcctggtgctggccgacggcacgacgccggccgactgggtg
gcgatggacctgttcagccaagccgaacacgacgaactggcgcagagcatcctgctcagc
cccgacgccggctacatcgccgcggtgcaggccgagatcgagcgcctgctgccggcgatg
ccgcgccaggcgacgatccgcgcctcgctcgaaggccgcggcgcgctgatccacacgcgt
tcgatggaagaagcctgcgagatcgccaaccgcgtcgcgcccgagcacctggaagtcagc
tcggccgaacccggccgctgggagccgctgctgcgccacgccggcgcgatcttcctcggc
gccttcaccagcgagagcctgggcgactactgcgccgggcccaaccacgtgctgccgacc
tcgggcaccgcgcgcttctcgtcgccgctgggcgtctacgatttccagaagcgcagcagc
ctgatcgaggtgagcgaagccggcgcccaggtgctgggcccgatcgccgccgagctggcc
tacggcgaagggctgcaggcccacgcccaggccgccgagttccgtctgaagccccgttga

DBGET integrated database retrieval system