KEGG   Rubrivivax gelatinosus: RGE_08720Help
Entry
RGE_08720         CDS       T01803                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rge  Rubrivivax gelatinosus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGE_08720 (ispE)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RGE_08720 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(902767..903648)
Genome map
AA seq 293 aa AA seqDB search
MTLRSLLDVPAPAKLNLFLHIVGRRADGYHLLQSPFVLIDWADTLHFERRDDGRIARHDL
GTALPPDDLCLRAARALQTASGTALGVDISIAKQLPSGAGMGGGSSDAATVLLALNRLWG
LDWPRERLLALGATLGADVPFFVGGRNAFVEGIGEKLTPIVLPRQWYAVVKPAEGLSTKE
IFEHPLLKRDTSAIVLGSPAEDKVVAEFSAGYGCNDMQPPAQDRCNDVAQALRFLERRYG
NSRMTGSGSAVFSRAGTGDRPLATFSEAELPEGWVGRMCRSLEHHPLVGWARD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcgatcgctgctcgacgtcccggccccggccaagctgaacctgttcctgcac
atcgtcggccgccgcgccgacggctatcacctgctgcagtcgccgttcgtgctgatcgac
tgggccgacacgctgcacttcgagcgccgcgacgacggccgcatcgcccgccacgacctc
ggcaccgcgttgccgcccgacgacctctgcctgcgcgctgcgcgggcgctgcagaccgcc
agcggcacggcgctgggcgtcgacatctcgatcgccaagcagttgccgtccggcgccggc
atgggcggcggcagctccgacgccgccaccgtgctgctggcgctgaaccgcctgtggggc
ctggactggccgcgcgagcgcctgctggcgctgggcgcgacgctgggcgccgacgtgccc
ttcttcgtcggcggccgcaacgccttcgtcgaaggcatcggcgaaaagctcacgccgatc
gtgctgccgcgccagtggtacgcggtcgtgaaacccgccgaagggctgtccacgaaagaa
atcttcgaacacccccttctcaaacgggatacatctgctatagtcttgggctctcccgca
gaggacaaagttgtcgcggaattcagtgcaggatacggttgcaacgacatgcagcccccc
gcgcaggaccgatgcaacgatgtggcgcaagccctgcgtttcctcgagcgacgttacggc
aacagccgcatgacgggctcaggcagcgcagtcttctcgagagcaggcacgggcgatcga
cccctggcgacattttcggaagccgagcttccggaaggttgggtcggacgaatgtgccgc
agtctggagcatcatccgctggtcggctgggctcgtgactaa

DBGET integrated database retrieval system