KEGG   Rubrivivax gelatinosus: RGE_08750Help
Entry
RGE_08750         CDS       T01803                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase/DNA-(apurinic or apyrimidinic site) lyase MutM (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rge  Rubrivivax gelatinosus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rge03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
906058..906882
Genome map
AA seq 274 aa AA seqDB search
MPELPEVEVTRRGIDEPLRGAQVLAVRLGKALRWGLGVEPETLIGARLLPVQRRGKYLWL
PLLGGCGGGLLLHLGMSGSLALQAEAPPPGPHDHFDLVTSQGTLRLTDPRRFGAVVWSPS
TVDPPAAKLLAALGAEPFDDSLTPAAFHAALQRHRAPIKAMLLSGRIVVGAGNIYACEAL
HAAGIHPATPCRRIGPVRAARLLQALRETLAQAIELGGSTLRDFRDAHGMDGAFQQHARV
YGRAGEACPRCGAPVRRIVQAQRATYFCAGCQRP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgcccgaagtcgaggtcacgcgcaggggcatagacgaaccgctgcgcggc
gcccaggtgctggccgtgcgcctgggcaaggcgctgcgctggggactgggcgtcgagccc
gaaaccctgatcggcgcccgcctgctgcccgtgcagcggcgtggcaaatacctctggctg
ccgctgctcggcggctgcggcggcgggctgctgctgcacctgggcatgtcgggatcgctc
gcgctgcaggccgaagcgccgccgcccgggccgcacgaccacttcgacctcgtcacgtcg
caaggcacgttgcggctgaccgacccgcggcgcttcggtgccgtcgtctggtcgccgtcg
accgtcgacccgccggcggcgaagctgctggccgcgctgggcgccgagcccttcgacgac
tcgctgacgccggccgccttccacgccgcgctgcagcgccaccgtgcgccgatcaaggcg
atgctgctgtcgggccgcatcgtcgtcggtgccggcaacatctacgcctgcgaggcgctg
cacgccgccggcatccacccggcgacaccctgccggcgcatcggcccggtgcgcgccgcg
cgcctgctgcaggcgctgcgcgagacgctggcgcaggcgatcgagctcggcggttcgacg
ctgcgcgacttccgcgacgcgcacggcatggacggtgcgttccagcagcacgcgcgggtc
tatggccgcgccggcgaagcctgcccgcgctgcggcgcgccggtgcgccgcatcgtgcag
gcgcaacgcgccacctacttctgcgccggctgccagcggccctga

DBGET integrated database retrieval system