KEGG   Rubrivivax gelatinosus: RGE_10060Help
Entry
RGE_10060         CDS       T01803                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1 PldA
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00564  Glycerophospholipid metabolism
rge00565  Ether lipid metabolism
rge00590  Arachidonic acid metabolism
rge00592  alpha-Linolenic acid metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RGE_10060 (pldA)
   00565 Ether lipid metabolism
    RGE_10060 (pldA)
   00590 Arachidonic acid metabolism
    RGE_10060 (pldA)
   00591 Linoleic acid metabolism
    RGE_10060 (pldA)
   00592 alpha-Linolenic acid metabolism
    RGE_10060 (pldA)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     RGE_10060 (pldA)
    3.1.1.32  phospholipase A1
     RGE_10060 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: BAL94347
UniProt: I0HMW0
Position
1051252..1052310
Genome map
AA seq 352 aa AA seqDB search
MSVRYLPLPLLCAWAAAVAQTPDERLAACAEIAAAPDRLACYDRLAGRAPVAPLPATETP
PTQLAARGAPVEDPAKPPSGSLLSRYWELDRADKRGIFNFVGYRPSYVMPVHYTDRINRR
PKSPTQPEVDQPNYRNVEAKFQLSVRAKLAQGLLLPDADLWFGYTQQVLWQIWNTTDSKP
FRNADYEPELIYMVPTPQGLQQLPLGWRWRYTELGLAHQSNGQSDPLSRSWNRSYLGAGF
ERGPWTLQARIAKRMSESRADDDNPDLVHYRGRADFTLGWASGPHAASLLYRTTLQEGRT
GAFQFEYSYPVFSDQPNGLRWYLQLFSGYGETLTDYNFRQNSIGLGLSFLQF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccgctatctgccgttgccgctgctctgcgcctgggccgccgccgtcgcccag
acgcccgacgaacgcctcgccgcctgcgcggagatcgccgccgcgcccgaccgcctggcc
tgctacgaccgcctggccggccgcgccccggtggcgccgctgccggccaccgagacgccg
ccgacacagctcgccgcgcgcggcgcgccggtggaagacccggccaagccgccgtccggc
agcctgctgtcgcgctattgggagctcgaccgcgccgacaaacgcggcatcttcaacttc
gtcggctaccggccgagctacgtgatgccggtgcactacaccgaccgcatcaaccggcga
ccgaagtcgccgacgcagcccgaggtcgaccagccgaactaccgcaacgtcgaagccaag
ttccagctctcggtgcgggccaagctggcccaggggctgctgctgcccgacgccgacctg
tggttcggctacacccagcaggtgctctggcagatctggaacaccacggactccaagccc
ttccgcaacgccgactacgagcccgagctgatctacatggtgccgacgccgcagggcctg
cagcagctgccgctgggctggcgctggcgctacaccgagctcggcctggcgcatcagtcc
aacggccagagcgacccgctgtcgcgcagctggaaccgcagctacctgggcgccggcttc
gagcgtggcccctggacgctgcaggcgcgcatcgccaagcgcatgagcgagtcgcgtgcc
gacgacgacaacccagacctcgtgcactaccgcggccgcgccgacttcacgctcggctgg
gcctcggggccgcacgccgcgtcgctgctgtaccgcacgacgctgcaggaaggccgcacc
ggcgccttccagttcgagtacagctacccggtgttctcggaccagcccaacggattgcgc
tggtatctgcagcttttcagcggttacggcgagacgctgaccgactacaacttccgccag
aacagcatcggcctggggctgagcttcctgcaattctga

DBGET integrated database retrieval system