KEGG   Rubrivivax gelatinosus: RGE_11170Help
Entry
RGE_11170         CDS       T01803                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rge  Rubrivivax gelatinosus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RGE_11170
Enzymes [BR:rge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RGE_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168564..1169214
Genome map
AA seq 216 aa AA seqDB search
MTYESERRQVVDLCLQLSHRGFFAGTGGNIMLRIDAELVAVTPSATDYLTMQPQDVCVLR
LADLSPVAGDRTPSVETGLHAQVLTRRPDVVCSIHTHQPVASALALIGRPLAVPQALHGL
LGAQVPVVGYAPSGSGWLARKLARTLRPDLNAYLMRNHGILCCGRGVREAMSAVSALEQI
AREQLLNGIRARAIANPPGREGLTQLAQSLSSEQSV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgaatccgaacgccgccaggtcgtcgacctgtgcctgcagctctcgcaccgg
ggcttcttcgccggcactggcggcaacatcatgctgcgcatcgacgccgagctggtcgcc
gtcacgccgtcggccaccgactacctgacgatgcagccgcaggacgtctgcgtgctgcgc
ctggccgacctgagcccggtggccggcgaccgcacgccttcggtcgagaccgggctgcac
gcccaggtgctgacccggcgccccgacgtcgtctgcagcatccacacgcaccagccggtg
gccagcgcgctggcgctgatcggccgcccgctggcggtgccgcaggcgctgcacgggctg
ctcggcgcgcaggtgccggtggtcggctacgcgccttcgggctcgggctggctggcgcgc
aagctggccaggacgctgcgccccgatctcaacgcctacctgatgcgcaaccacgggatc
ctgtgctgcggccgtggcgtgcgcgaggcgatgtcggccgtctccgcgctcgaacagatc
gcgcgcgagcagcttttgaacggcatccgggcgcgagccatcgcgaacccgccgggacgc
gagggcctgacgcagctggcgcagtccctgtcgagcgagcaatccgtctga

DBGET integrated database retrieval system