KEGG   Rubrivivax gelatinosus: RGE_11170Help
Entry
RGE_11170         CDS       T01803                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rge  Rubrivivax gelatinosus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rge00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168564..1169214
Genome map
AA seq 216 aa AA seqDB search
MTYESERRQVVDLCLQLSHRGFFAGTGGNIMLRIDAELVAVTPSATDYLTMQPQDVCVLR
LADLSPVAGDRTPSVETGLHAQVLTRRPDVVCSIHTHQPVASALALIGRPLAVPQALHGL
LGAQVPVVGYAPSGSGWLARKLARTLRPDLNAYLMRNHGILCCGRGVREAMSAVSALEQI
AREQLLNGIRARAIANPPGREGLTQLAQSLSSEQSV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgaatccgaacgccgccaggtcgtcgacctgtgcctgcagctctcgcaccgg
ggcttcttcgccggcactggcggcaacatcatgctgcgcatcgacgccgagctggtcgcc
gtcacgccgtcggccaccgactacctgacgatgcagccgcaggacgtctgcgtgctgcgc
ctggccgacctgagcccggtggccggcgaccgcacgccttcggtcgagaccgggctgcac
gcccaggtgctgacccggcgccccgacgtcgtctgcagcatccacacgcaccagccggtg
gccagcgcgctggcgctgatcggccgcccgctggcggtgccgcaggcgctgcacgggctg
ctcggcgcgcaggtgccggtggtcggctacgcgccttcgggctcgggctggctggcgcgc
aagctggccaggacgctgcgccccgatctcaacgcctacctgatgcgcaaccacgggatc
ctgtgctgcggccgtggcgtgcgcgaggcgatgtcggccgtctccgcgctcgaacagatc
gcgcgcgagcagcttttgaacggcatccgggcgcgagccatcgcgaacccgccgggacgc
gagggcctgacgcagctggcgcagtccctgtcgagcgagcaatccgtctga

DBGET integrated database retrieval system