KEGG   Rubrivivax gelatinosus: RGE_12270Help
Entry
RGE_12270         CDS       T01803                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00020  Citrate cycle (TCA cycle)
rge00190  Oxidative phosphorylation
rge00650  Butanoate metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Module
rge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rge_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_12270 (sdhD)
   00650 Butanoate metabolism
    RGE_12270 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RGE_12270 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_D CybS
Motif
Other DBs
NCBI-ProteinID: BAL94568
UniProt: I0HNI1
Position
1276181..1276543
Genome map
AA seq 120 aa AA seqDB search
MSKNYGPERLVVGAHYGARDWLAQRITAAVIAVFTFVLLVQLLAPGPLGYDRWAGIFSAQ
WMKVLTFVVIVSLAWHAWIGIRDIWMDYVKPAAVRLTLQVLSIVWLVGCAGWAVQVLWRL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaactacggtcccgagcgcctcgtcgtcggcgctcactacggtgcgcgcgac
tggctcgcgcagcgcatcaccgccgcggtgatcgccgtcttcaccttcgtgctgctggtt
cagctgctcgcgccgggcccgctcggctacgaccgctgggccggcatcttctcggcgcaa
tggatgaaggtgctgaccttcgtcgtcatcgtgtcgctcgcgtggcatgcctggatcggc
atccgcgacatctggatggattacgtcaagcccgcagccgtcaggctgaccctgcaggtg
ctgtccatcgtctggctcgtcggctgcgccggctgggccgtgcaagtgctctggagactc
tga

DBGET integrated database retrieval system