KEGG   Rubrivivax gelatinosus: RGE_12270Help
Entry
RGE_12270         CDS       T01803                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit SdhD (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rge  Rubrivivax gelatinosus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_12270 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_12270 (sdhD)
   00650 Butanoate metabolism
    RGE_12270 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RGE_12270 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1276181..1276543
Genome map
AA seq 120 aa AA seqDB search
MSKNYGPERLVVGAHYGARDWLAQRITAAVIAVFTFVLLVQLLAPGPLGYDRWAGIFSAQ
WMKVLTFVVIVSLAWHAWIGIRDIWMDYVKPAAVRLTLQVLSIVWLVGCAGWAVQVLWRL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaactacggtcccgagcgcctcgtcgtcggcgctcactacggtgcgcgcgac
tggctcgcgcagcgcatcaccgccgcggtgatcgccgtcttcaccttcgtgctgctggtt
cagctgctcgcgccgggcccgctcggctacgaccgctgggccggcatcttctcggcgcaa
tggatgaaggtgctgaccttcgtcgtcatcgtgtcgctcgcgtggcatgcctggatcggc
atccgcgacatctggatggattacgtcaagcccgcagccgtcaggctgaccctgcaggtg
ctgtccatcgtctggctcgtcggctgcgccggctgggccgtgcaagtgctctggagactc
tga

DBGET integrated database retrieval system