KEGG   Rubrivivax gelatinosus: RGE_12540Help
Entry
RGE_12540         CDS       T01803                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_12540 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_12540 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RGE_12540 (trpB)
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RGE_12540 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1306523..1307770
Genome map
AA seq 415 aa AA seqDB search
MLNYDQPDARGHFGPYGGSFVAETLTHALHELQDAYARYREDPEFVAEYRYELKHFVGRP
SPIYHAARTSRELGGAQIYLKREDLNHTGAHKINNVIGQALLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVYRMHLLGAKVVPVESGSKTLKDALNEALR
DWVTNVENTFYIIGTVAGPAPYPAMVRDFQRIIGDECLEQMPELAGRQPDAVIACVGGGS
NAMGIFYPYIRHEATRLIGVEAAGQGLETGKHAASLSAGSPGVLHGNRTYLLQDDNGQIT
ETHSISAGLDYPGVGPEHAYLKDIGRAEYVGITDDEALKAFHHLCRTEGIIPALESSHAL
AHAMKIAPTMRPDQILLVNLSGRGDKDIGTVADLSGADFYCRPSCRGQTVKGGQQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctgaattacgaccagcccgatgcccgcgggcatttcgggccttatggcggcagtttc
gtcgccgaaaccctgacccacgcgctgcacgaactgcaggacgcctacgcccgctaccgc
gaggaccccgagttcgtggccgagtatcgctacgagctgaagcacttcgtcggccgcccg
agcccgatctaccacgccgcgcgcaccagccgcgaactcggcggcgcgcagatctacctg
aagcgcgaggacttgaaccacaccggcgcgcacaagatcaacaacgtcatcggccaggcg
ctgctcgccaggcgcatgggcaagccgcgcgtgatcgccgagaccggcgccggccagcac
ggcgtcgccacggcgacgatctgcgcgcgctacggcctggagtgcgtggtctacatgggc
agcgaggacgtcaagcgccagagccccaacgtctaccgcatgcatctgctcggcgccaag
gtcgtgccggtggaaagcggcagcaagacgctgaaggacgcgctcaacgaggcgctgcgc
gactgggtcaccaacgtcgagaacaccttctacatcatcggcacggtggccggcccggcg
ccgtacccggcgatggtgcgcgacttccagcgcatcatcggcgacgagtgcctggagcag
atgcccgaactcgccggccgccagcccgacgcggtgatcgcctgcgtcggcggcggcagc
aacgcgatgggcatcttctacccgtacatccgccacgaagccacgcggctgatcggcgtc
gaggccgcggggcagggcctggagaccggcaaacacgccgcgtcgctgtcggccggctcg
cccggcgtgctgcacggcaaccgcacctatctgctgcaggacgacaacggccagatcacc
gagacgcactcgatctcggccggcctcgactaccccggcgtcggccccgagcacgcgtat
ctgaaggacatcggccgtgccgagtacgtcggcatcaccgacgacgaggcgctgaaggcc
ttccaccacctctgccgcaccgagggcatcatcccggcgctggagtccagccacgcactg
gcccacgcgatgaagatcgcgccgacgatgcgccccgaccagatcctgctggtcaacctc
tccggccgcggcgacaaggacatcggcaccgtcgccgacctgtccggtgccgacttctat
tgccgcccctcgtgccgcggccagacggtgaaggggggccagcaatga

DBGET integrated database retrieval system