KEGG   Rubrivivax gelatinosus: RGE_12550Help
Entry
RGE_12550         CDS       T01803                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_12550 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_12550 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RGE_12550 (trpA)
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RGE_12550 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1307767..1308576
Genome map
AA seq 269 aa AA seqDB search
MSRIAATFEALARDGRQALIPYVTTGDPYADATPEIMAALAEGGADVIELGVPFSDPMAD
GPVIQQAGERALARGIGLAQVFAAVRAFREHNQHTPVVLMGYANPVERYDGRHGDGAFIR
DAAAAGVDGVLIVDYPPEECEDFAARLKAAELDLIFLLAPTSTDERMRQVGRLASGYVYY
VSLKGVTGAGHLDTAAVAAMLPRIRAQVQTPVGVGFGIRDAATARAVAEVADAVVIGSRL
VQLLAEQPREAVAAAARDFIAGIRAALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgccgccaccttcgaggccctggcccgtgacggccgccaggcgctgatt
ccctacgtcaccaccggcgacccgtacgccgacgcgacgcccgagatcatggccgcgctg
gccgagggcggcgccgacgtcatcgagctcggcgtgccgttctccgacccgatggccgac
ggcccggtgatccagcaggccggcgaacgcgcgctggcgcgcggcatcggcctggcccag
gtcttcgccgcggtgcgcgccttccgcgagcacaaccagcacacgccggtcgtgctgatg
ggctacgccaacccggtcgagcgctacgacggccgccacggcgacggcgccttcatccgc
gacgcggcggccgccggtgtcgacggcgtgctgatcgtcgactacccgcccgaggagtgc
gaggacttcgccgcgcgcctgaaggccgcggagctggacctgatcttcctgctggcgccg
acctccaccgacgagcgcatgcgccaggtcggacggctggccagcgggtatgtgtactat
gtctcgctgaaaggcgtcaccggcgcgggtcacctcgacaccgcggcggtggcggcgatg
ttgccgcgcatccgcgcgcaggttcagacgccggtcggcgtcggcttcggcatccgcgac
gccgcgacggcgcgcgcggtcgcggaggtcgccgacgcggtcgtcatcggctcgcggctg
gtgcagctgctcgccgagcagccgcgcgaggccgtggccgccgcggcgcgcgacttcatc
gccggcatccgcgccgcgctggacgcataa

DBGET integrated database retrieval system