KEGG   Rubrivivax gelatinosus: RGE_15550Help
Entry
RGE_15550         CDS       T01803                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00010  Glycolysis / Gluconeogenesis
rge00051  Fructose and mannose metabolism
rge00562  Inositol phosphate metabolism
rge00710  Carbon fixation in photosynthetic organisms
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
rge01230  Biosynthesis of amino acids
Module
rge_M00002  Glycolysis, core module involving three-carbon compounds
rge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_15550 (tpiA)
   00051 Fructose and mannose metabolism
    RGE_15550 (tpiA)
   00562 Inositol phosphate metabolism
    RGE_15550 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RGE_15550 (tpiA)
Enzymes [BR:rge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RGE_15550 (tpiA)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RGE_15550 (tpiA)
  Exosomal proteins of bladder cancer cells
   RGE_15550 (tpiA)
  Exosomal proteins of melanoma cells
   RGE_15550 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM tRNA-Thr_ED
Motif
Other DBs
NCBI-ProteinID: BAL94896
UniProt: I0HPF9
Position
1595736..1596476
Genome map
AA seq 246 aa AA seqDB search
MRRKLVVGNWKMHGSRPANAELLAALIAGRPYAADVAVCVPNVFLSETAATLAGSELRWG
AQDVSEHEQGAYTGEVSAAMLAECGCRYAIVGHSERRAYHAESDAVVARKAQAALARGVT
PIVCVGETLEQRDAGETEAVVKRQLSAVIHQLAHCASEIVVAYEPVWAIGTGRTATPEQA
QAVHAVLRAQLHAATGRGHTMRILYGGSVKADNAATLFAQPDIDGGLIGGASLKAADFIA
ICRAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaagctcgtggtgggcaactggaagatgcatggcagccgcccggccaatgcc
gagctgctggccgcgctgatcgccggccgtccttacgccgccgacgtggcggtctgcgtg
cccaacgtgttcctgtccgagaccgcggcgacgctggccggcagcgagctgcgctggggt
gcgcaggacgtctccgagcacgagcagggcgcctacaccggcgaggtgtcggcggcgatg
ctggccgaatgcggctgccgctacgccatcgtcggccactcggagcgccgtgcctaccac
gccgagagcgacgccgtcgtcgcgcgcaaggcgcaggcggcgctggcgcgcggcgtgacg
ccgatcgtctgcgtcggcgagacgctggagcagcgcgacgccggcgagaccgaagcggtc
gtcaagcgccagctttcggcggtgatccaccagctggcgcactgcgccagcgagatcgtc
gtcgcctacgagcccgtctgggccatcggcaccggccgcaccgcgacgcccgaacaggcg
caggcggtgcatgccgtgctgcgcgcgcagctgcacgcggccaccggtcgcgggcacacg
atgcgcatcctctacggcggcagcgtcaaggcggacaacgccgcgacgctgttcgcgcaa
cccgacatcgacggcgggctgatcggcggtgcttcgctgaaggctgccgacttcatcgcg
atctgccgcgccgcggcctga

DBGET integrated database retrieval system