KEGG   Rubrivivax gelatinosus: RGE_15550Help
Entry
RGE_15550         CDS       T01803                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rge01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rge01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rge00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rge00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rge00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rge00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1595736..1596476
Genome map
AA seq 246 aa AA seqDB search
MRRKLVVGNWKMHGSRPANAELLAALIAGRPYAADVAVCVPNVFLSETAATLAGSELRWG
AQDVSEHEQGAYTGEVSAAMLAECGCRYAIVGHSERRAYHAESDAVVARKAQAALARGVT
PIVCVGETLEQRDAGETEAVVKRQLSAVIHQLAHCASEIVVAYEPVWAIGTGRTATPEQA
QAVHAVLRAQLHAATGRGHTMRILYGGSVKADNAATLFAQPDIDGGLIGGASLKAADFIA
ICRAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaagctcgtggtgggcaactggaagatgcatggcagccgcccggccaatgcc
gagctgctggccgcgctgatcgccggccgtccttacgccgccgacgtggcggtctgcgtg
cccaacgtgttcctgtccgagaccgcggcgacgctggccggcagcgagctgcgctggggt
gcgcaggacgtctccgagcacgagcagggcgcctacaccggcgaggtgtcggcggcgatg
ctggccgaatgcggctgccgctacgccatcgtcggccactcggagcgccgtgcctaccac
gccgagagcgacgccgtcgtcgcgcgcaaggcgcaggcggcgctggcgcgcggcgtgacg
ccgatcgtctgcgtcggcgagacgctggagcagcgcgacgccggcgagaccgaagcggtc
gtcaagcgccagctttcggcggtgatccaccagctggcgcactgcgccagcgagatcgtc
gtcgcctacgagcccgtctgggccatcggcaccggccgcaccgcgacgcccgaacaggcg
caggcggtgcatgccgtgctgcgcgcgcagctgcacgcggccaccggtcgcgggcacacg
atgcgcatcctctacggcggcagcgtcaaggcggacaacgccgcgacgctgttcgcgcaa
cccgacatcgacggcgggctgatcggcggtgcttcgctgaaggctgccgacttcatcgcg
atctgccgcgccgcggcctga

DBGET integrated database retrieval system