KEGG   Rubrivivax gelatinosus: RGE_15550Help
Entry
RGE_15550         CDS       T01803                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_15550 (tpiA)
   01230 Biosynthesis of amino acids
    RGE_15550 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_15550 (tpiA)
   00051 Fructose and mannose metabolism
    RGE_15550 (tpiA)
   00562 Inositol phosphate metabolism
    RGE_15550 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RGE_15550 (tpiA)
Enzymes [BR:rge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RGE_15550 (tpiA)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RGE_15550 (tpiA)
  Exosomal proteins of bladder cancer cells
   RGE_15550 (tpiA)
  Exosomal proteins of melanoma cells
   RGE_15550 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1595736..1596476
Genome map
AA seq 246 aa AA seqDB search
MRRKLVVGNWKMHGSRPANAELLAALIAGRPYAADVAVCVPNVFLSETAATLAGSELRWG
AQDVSEHEQGAYTGEVSAAMLAECGCRYAIVGHSERRAYHAESDAVVARKAQAALARGVT
PIVCVGETLEQRDAGETEAVVKRQLSAVIHQLAHCASEIVVAYEPVWAIGTGRTATPEQA
QAVHAVLRAQLHAATGRGHTMRILYGGSVKADNAATLFAQPDIDGGLIGGASLKAADFIA
ICRAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaagctcgtggtgggcaactggaagatgcatggcagccgcccggccaatgcc
gagctgctggccgcgctgatcgccggccgtccttacgccgccgacgtggcggtctgcgtg
cccaacgtgttcctgtccgagaccgcggcgacgctggccggcagcgagctgcgctggggt
gcgcaggacgtctccgagcacgagcagggcgcctacaccggcgaggtgtcggcggcgatg
ctggccgaatgcggctgccgctacgccatcgtcggccactcggagcgccgtgcctaccac
gccgagagcgacgccgtcgtcgcgcgcaaggcgcaggcggcgctggcgcgcggcgtgacg
ccgatcgtctgcgtcggcgagacgctggagcagcgcgacgccggcgagaccgaagcggtc
gtcaagcgccagctttcggcggtgatccaccagctggcgcactgcgccagcgagatcgtc
gtcgcctacgagcccgtctgggccatcggcaccggccgcaccgcgacgcccgaacaggcg
caggcggtgcatgccgtgctgcgcgcgcagctgcacgcggccaccggtcgcgggcacacg
atgcgcatcctctacggcggcagcgtcaaggcggacaacgccgcgacgctgttcgcgcaa
cccgacatcgacggcgggctgatcggcggtgcttcgctgaaggctgccgacttcatcgcg
atctgccgcgccgcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system