KEGG   Rubrivivax gelatinosus: RGE_16580Help
Entry
RGE_16580         CDS       T01803                                 

Gene name
bchI
Definition
(GenBank) protoporphyrin IX magnesium-chelatase BchI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00860  Porphyrin and chlorophyll metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RGE_16580 (bchI)
Enzymes [BR:rge01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RGE_16580 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 AAA_16 Sigma54_activat MCM AAA_29 AAA DUF815 AAA_18 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: BAL94999
UniProt: I0HPR2
Position
1713394..1714389
Genome map
AA seq 331 aa AA seqDB search
MKLTYPFSAIVGQDEMKLAILIAAVDPSVGGVLVFGDRGTGKSTAVRALAALLPKMKAVV
GCPYNRDPALEPADAPKPKTHQVPVPVVDLPLGATEDRVVGALDLERALSQGVKAFEPGL
LARANRGFLYIDEVNLLEDHLVDLLIDVAASGENVVEREGLSVRHPARFVLVGSGNPEEG
ELRPQLLDRFGLSVEVKTPTDIPVRIEIVRRRDAFERDPEGFTEKWKAEDDKIRRRILAA
RKRLEDVQVPDAALERAAQLCMKLGTDGLRGELTLMRAARALAAIDGDKAVGDSQLKRIA
APALRHRLRRNVLDDAGSTVRVDRAVQELFA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacgtatcccttctcggccatcgtcggccaggacgagatgaagctcgccatc
ctcatcgccgcggtggacccgagcgtgggcggggtgctggtcttcggcgaccgcggcacc
ggcaagtcgaccgccgtgcgtgcgctggcggcgctgctccccaagatgaaggccgtcgtc
ggctgcccctacaaccgcgacccggcgctcgagcctgccgacgcgcccaagcccaagacg
caccaggtgccggtgccggtcgtcgacctgccgctgggtgccaccgaagaccgcgtcgtc
ggcgcgctcgacctggagcgtgcgctgtcgcaaggcgtcaaggctttcgagcccggcctg
ctggcgcgcgccaaccgcggcttcctgtacatcgacgaagtcaacctgctcgaagaccac
ctggtcgacctgctgatcgacgtcgccgcctcgggcgagaacgtcgtcgagcgcgaaggc
ctgtcggtgcgccaccccgcgcgcttcgtgctggtcggctcgggcaacccggaagaaggc
gaactgcggccgcagctgctcgaccgtttcggcctgtcggtcgaggtcaagacgccgacc
gacatcccggtgcgcatcgagatcgtgcgccgccgcgacgccttcgaacgcgaccccgag
ggcttcaccgagaagtggaaggccgaggacgacaagatccgccgccgcatcctggccgcg
cgcaagcgcctggaagacgtgcaggtgcccgacgcggcgctggagcgcgccgcccagctg
tgcatgaagctcggcaccgacggcctgcgcggcgagctgacgctgatgcgtgccgcgcgc
gcgctggccgcgatcgacggcgacaaggccgtcggcgacagccagctgaagcgcatcgcc
gcgccggcgctgcgccaccgcctgcgccgcaacgtgctcgacgacgccggttccacggtg
cgcgtggatcgcgcggtgcaggaactgttcgcctga

DBGET integrated database retrieval system