KEGG   Rubrivivax gelatinosus: RGE_16590Help
Entry
RGE_16590         CDS       T01803                                 

Gene name
bchD
Definition
protoporphyrin IX magnesium-chelatase BchD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rge00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1714389..1716134
Genome map
AA seq 581 aa AA seqDB search
MSSKAWEDATLAAAVFAVDPAGIGGVHLRSPAGPVRDRWLAALSRALPAPPRRMPVGIAD
DRLLGGLDLAGTLQAGRPVAQRGLLADADGGVVLAVMAERLPPGTAAKMAAVMDRQEVVV
ERDGVALSHPTRFGVVAFDEGGPDDDPVPIALTDRLGLKLDFTQIPPREAPEIDFGDVSD
ARALLPRVRCGDEALQALVQAAVALGIASLRAPLHALRVACAHAALNGRETVEAEDAAAA
ARLVFAPRATQLPAPPEQEAPPEEPPPPPPDQQDPNQDPPPPDDEQQAEELKGPMEDQVL
DAVLASLPPALLAQMQADYASRERARSSGKSGALHKGGHRGRPSGIRRGEPKAGQRLNLI
ATLRAAAPWQRVRGAIKPRVQVRPDDFHVTHYRQRRETTTIFVVDASGSSALNRMAEAKG
AVELLLADCYVRRDKVAVIAFRGKAAELLLPPTRSLVRAKRSLAGLPGGGGTPLAAAVDA
AGALAESIRRRGDTPLVVFLTDGRANVALDGTGGRPKAEADALDAAKRMLASGAATMLID
TSPQPAAQARKIAGAMQATYMPLPYAGAQTLSQVVRARAGG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaaggcctgggaagacgccacgctggcggcggcggtgttcgccgtcgacccg
gcgggcatcggcggcgtgcacctgcgctcgccggccggcccggtgcgtgaccgctggctc
gcggcgctgtcgcgcgcgctgccggcgccgccgcggcgcatgccggtgggcatcgccgac
gaccgcctgctcggcggcctggacctcgccggcactctgcaggccgggcgcccggtcgcg
cagcgtggcctgctcgccgacgccgacggcggcgtcgtgctcgcggtgatggccgagcgc
ctgccgccgggcaccgcggcgaagatggccgcggtgatggaccgccaagaggtcgtcgtc
gaacgcgacggcgtcgcgctctcgcacccgacacgtttcggcgtcgtcgccttcgacgaa
ggcggccccgacgacgacccggtgccgatcgcgctgaccgaccgcctggggctcaagctc
gacttcacgcagatcccgccgcgcgaggcgccggagatcgacttcggcgacgtctccgac
gcgcgcgcgctgctgccgcgcgtgcgctgcggcgacgaggcgctgcaggcgctggtgcag
gccgccgtcgcgctgggcatcgcctcgctgcgcgcgccgctgcacgccttgcgcgtggcc
tgcgcgcacgccgcgctgaacggccgcgagaccgtcgaggccgaggacgccgccgcagca
gcgcgcctggtgttcgcgccgcgcgcgacgcagctgccggcgccgcccgagcaggaagcc
ccgcccgaggagccgccgcctccgccgccggatcagcaggacccgaaccaggacccgcca
ccgccggacgacgagcagcaggccgaagagctgaagggcccgatggaagaccaggtgctc
gacgccgtgctcgcgtcgctgccgccggcgctgctggcgcagatgcaggccgactacgcc
tcgcgcgaacgcgcgcgttcgtcgggcaagtcgggcgcgctgcacaagggcggccaccgc
ggccggccgtcgggcatccgccgcggcgagcccaaggccggccagcgcctgaacctgatc
gcgacgctgcgcgctgccgcgccctggcaacgggtgcgcggcgccatcaagccgcgtgtg
caggtgcggcccgacgacttccacgtcacgcactaccgccagcggcgcgagacgacgacg
atcttcgtcgtcgacgcctcgggctcgtcggcgctcaaccgcatggccgaggccaagggc
gcggtcgagctgctgctggccgactgctacgtgcggcgcgacaaggtggcggtgatcgcc
ttccgcggcaaggccgccgaactgctgctgccgccgacacgttcgctggtgcgcgccaag
cgcagcctggccggcctgcccggcggcggcggcacgccgctggcggcggccgtcgatgcc
gccggggcgctggccgagtcgatccgccggcgtggcgacacgccgctggtggtcttcctg
accgacggccgcgccaacgtcgcgctcgacggcaccggcgggcgccccaaggccgaggcc
gatgcgctcgacgcggccaagcgcatgctggccagcggcgcggcgacgatgctgatcgac
acttcgccgcagccggcggcgcaggcgcgcaagatcgccggcgcgatgcaggccacctac
atgccgctgccttacgccggcgcgcagaccctgtcgcaggtggtgcgcgcacgcgccggt
ggctga

DBGET integrated database retrieval system