KEGG   Rubrivivax gelatinosus: RGE_17280Help
Entry
RGE_17280         CDS       T01803                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rge  Rubrivivax gelatinosus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1785391..1786254)
Genome map
AA seq 287 aa AA seqDB search
MTPDLPGPLQLPAGPHAVLLLHGLCSGPQELQFLARGLQRAGYTVRLPVLPGYSHGLPAS
ESTQARWRAAALAEFDALAAAHDSVAVGGLCIGAVLALHVAAARPGAVAACIGLSTTLYY
DGWATPWTRRLLPLARVLPGARRILVRERAPYGVKDERMRAFIERQMNQSGSSDAGAAAL
SVHHLLEARELIAGLRPQLAAVDAPTLLVHAREDEAVSPRSALEAARELVAARVRCVLLN
DSYHMLSIDREKHTVLAEMRAFLDQEQRGGRADLHALPLQPTARACA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactccagatcttcccggcccgctgcagctgccggccggtccgcacgcggtgctgctg
ctgcacggcctgtgcagcggcccgcaggagctgcagttcctggcccgcgggctgcagcgc
gccggctacaccgtgcgcctgccggtgctgcccggctactcgcacggcctgccggccagc
gaatcgacgcaggcccgctggcgtgccgcggcgctggccgagttcgacgccctggccgcc
gcgcacgacagcgtcgccgtcggcgggctgtgcatcggcgccgtgctggcgctgcacgtg
gccgccgcgcggccgggcgccgtcgccgcctgcatcggcctgtcgacgacgctgtactac
gacggctgggcgacgccctggacacgccgcctgctgccgctggcgcgcgtgctgcccggc
gcccgccgcatcctcgtgcgcgagcgtgcgccctacggcgtgaaggacgagcgcatgcgc
gccttcatcgagcgccagatgaaccagtcgggcagctccgacgccggcgccgcggcgctg
tcggtgcaccacctgctcgaagcgcgcgagctgatcgccgggctgcggccgcagctggcc
gcggtcgacgcgccgacgctgctggtgcacgcccgcgaggacgaggcggtgtcgccgcgc
agcgcgctcgaagcggcacgcgagctcgtcgccgcacgcgtgcgctgcgtgctgctcaac
gacagctaccacatgctcagcatcgaccgcgagaagcacaccgtgctcgccgagatgcgc
gcctttctcgaccaggagcaacgcggcggccgcgccgacctgcatgccctgcccctgcaa
cccaccgcgcgcgcctgcgcctga

DBGET integrated database retrieval system