KEGG   Rubrivivax gelatinosus: RGE_17430Help
Entry
RGE_17430         CDS       T01803                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rge  Rubrivivax gelatinosus
Brite
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RGE_17430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1804963..1806612
Genome map
AA seq 549 aa AA seqDB search
MSAATPAQIAKGALRRLAMAKLEPTPEHYARAYAEEAGLPVSPLADPKAQGPAWAALIEK
LVKGVERGGRQWTTARKKESLQRVLDGSRGDLQRLQQRLQALASAWDGDRHFEDPEAPPG
AADDAPPLEMPPTMPAPLDEAPAADPVVTPEPWRPVVSSLEGALRAGLPPEEPRAAEIAD
RLAALADAIAAEGVSAERVAEVDELCARARRLFAHRHHLVEQLGTLCRELSRGLVEVAED
DSWARGQCESLEQRLADGVTARSVRAATELLAETRTRQQRVRDERNAARDALKSLIHRML
AEVGALGEHTGRFHESVGRHAEAVARAESLESLAGVVREIVDESRAVQELVGAAQRRMED
EHAKANELETRVRELEGELRRLSDEVSTDALTQVANRRGLAQAFDAERARVDRAGPEAPP
LAIGLIDIDNFKRLNDTLGHAAGDLALKSLAGAVRERLRPVDHLARFGGEEFVVLLPATP
LAEAQQALTRLQRGLTEALFLHEQREVFVTFSAGVTAWRPGEALEAALERADEALYEAKR
SGKNRTCTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgaccccggcgcagatcgccaagggcgcgctgcggcgcctggccatggcc
aagctcgagccgacgcccgaacactatgcgcgcgcctacgccgaggaggccggcctgccg
gtctcgccgctggccgacccaaaggcccagggcccggcctgggcggcgctgatcgagaag
ctcgtcaagggcgtcgaacgaggcggccggcagtggaccacggcgcgcaagaaggagagc
ctgcagcgcgtgctcgacggcagccgcggcgacctgcagcggctgcagcagcggctgcag
gcgctggccagcgcctgggacggcgaccggcatttcgaggatccggaggcgccgcccggc
gccgccgacgacgcgccgccgctggagatgccgccgacgatgccggcaccgctggacgaa
gcgccggccgccgacccggtcgtcacgcccgagccctggcgtccggtcgtctccagcctt
gaaggcgcgctgcgcgccggcctgccgcccgaggagccgcgtgccgccgagatcgccgac
cgcctggcggcgctggccgacgcgatcgccgccgaaggcgtgtcggccgaacgggtcgcc
gaggtcgacgagctctgcgcgcgcgcgcgccggctcttcgcccaccgccaccatctcgtc
gagcagctcggcacgctgtgccgcgagctgagccgcggcctggtcgaggtcgccgaggac
gacagctgggcgcgtggccagtgcgagagcctggagcagcgcctggccgacggcgtcacc
gcgcgcagcgtgcgcgccgccaccgagctgctggccgagacccgcacccgccagcagcgt
gtgcgcgacgagcgcaatgccgcgcgcgacgcgctgaagtcgctgatccaccgcatgctg
gccgaggtcggcgccctgggcgaacacaccgggcgcttccacgagagcgtcggccgccac
gccgaggccgtggcgcgtgccgagtcgctggagagcctggccggcgtggtgcgcgagatc
gtcgacgagagccgcgccgtgcaggagctggtcggcgccgcgcagcggcgcatggaagac
gaacacgccaaggccaacgagctcgagacccgcgtgcgcgagctcgagggcgagctgcgc
cggctgtccgacgaggtctcgaccgacgcgctgacccaggtcgccaaccgccgcggcctg
gcccaggccttcgacgccgaacgcgcgcgcgtcgaccgcgccggccccgaggcgccgccg
ctggcgatcggtctgatcgacatcgacaacttcaagcggctcaacgacacgctgggccac
gccgccggcgacctggcgctgaagtcgctggccggcgcggtgcgcgagcgcctgcgcccg
gtggaccacctggcgcgcttcggcggcgaggagttcgtcgtgctgctgccagccacgccg
ctggccgaggcccagcaggcgctgacgcggctgcagcgcggcctgaccgaggccctgttc
ctgcacgagcagcgcgaggtcttcgtcaccttctctgccggcgtcaccgcctggcgcccg
ggcgaggcgctcgaagccgcgctcgaacgcgccgacgaagcgctctacgaagccaagcgc
agcgggaagaaccgcacctgcaccgcctga

DBGET integrated database retrieval system