KEGG   Rubrivivax gelatinosus: RGE_17430Help
Entry
RGE_17430         CDS       T01803                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1804963..1806612
Genome map
AA seq 549 aa AA seqDB search
MSAATPAQIAKGALRRLAMAKLEPTPEHYARAYAEEAGLPVSPLADPKAQGPAWAALIEK
LVKGVERGGRQWTTARKKESLQRVLDGSRGDLQRLQQRLQALASAWDGDRHFEDPEAPPG
AADDAPPLEMPPTMPAPLDEAPAADPVVTPEPWRPVVSSLEGALRAGLPPEEPRAAEIAD
RLAALADAIAAEGVSAERVAEVDELCARARRLFAHRHHLVEQLGTLCRELSRGLVEVAED
DSWARGQCESLEQRLADGVTARSVRAATELLAETRTRQQRVRDERNAARDALKSLIHRML
AEVGALGEHTGRFHESVGRHAEAVARAESLESLAGVVREIVDESRAVQELVGAAQRRMED
EHAKANELETRVRELEGELRRLSDEVSTDALTQVANRRGLAQAFDAERARVDRAGPEAPP
LAIGLIDIDNFKRLNDTLGHAAGDLALKSLAGAVRERLRPVDHLARFGGEEFVVLLPATP
LAEAQQALTRLQRGLTEALFLHEQREVFVTFSAGVTAWRPGEALEAALERADEALYEAKR
SGKNRTCTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgaccccggcgcagatcgccaagggcgcgctgcggcgcctggccatggcc
aagctcgagccgacgcccgaacactatgcgcgcgcctacgccgaggaggccggcctgccg
gtctcgccgctggccgacccaaaggcccagggcccggcctgggcggcgctgatcgagaag
ctcgtcaagggcgtcgaacgaggcggccggcagtggaccacggcgcgcaagaaggagagc
ctgcagcgcgtgctcgacggcagccgcggcgacctgcagcggctgcagcagcggctgcag
gcgctggccagcgcctgggacggcgaccggcatttcgaggatccggaggcgccgcccggc
gccgccgacgacgcgccgccgctggagatgccgccgacgatgccggcaccgctggacgaa
gcgccggccgccgacccggtcgtcacgcccgagccctggcgtccggtcgtctccagcctt
gaaggcgcgctgcgcgccggcctgccgcccgaggagccgcgtgccgccgagatcgccgac
cgcctggcggcgctggccgacgcgatcgccgccgaaggcgtgtcggccgaacgggtcgcc
gaggtcgacgagctctgcgcgcgcgcgcgccggctcttcgcccaccgccaccatctcgtc
gagcagctcggcacgctgtgccgcgagctgagccgcggcctggtcgaggtcgccgaggac
gacagctgggcgcgtggccagtgcgagagcctggagcagcgcctggccgacggcgtcacc
gcgcgcagcgtgcgcgccgccaccgagctgctggccgagacccgcacccgccagcagcgt
gtgcgcgacgagcgcaatgccgcgcgcgacgcgctgaagtcgctgatccaccgcatgctg
gccgaggtcggcgccctgggcgaacacaccgggcgcttccacgagagcgtcggccgccac
gccgaggccgtggcgcgtgccgagtcgctggagagcctggccggcgtggtgcgcgagatc
gtcgacgagagccgcgccgtgcaggagctggtcggcgccgcgcagcggcgcatggaagac
gaacacgccaaggccaacgagctcgagacccgcgtgcgcgagctcgagggcgagctgcgc
cggctgtccgacgaggtctcgaccgacgcgctgacccaggtcgccaaccgccgcggcctg
gcccaggccttcgacgccgaacgcgcgcgcgtcgaccgcgccggccccgaggcgccgccg
ctggcgatcggtctgatcgacatcgacaacttcaagcggctcaacgacacgctgggccac
gccgccggcgacctggcgctgaagtcgctggccggcgcggtgcgcgagcgcctgcgcccg
gtggaccacctggcgcgcttcggcggcgaggagttcgtcgtgctgctgccagccacgccg
ctggccgaggcccagcaggcgctgacgcggctgcagcgcggcctgaccgaggccctgttc
ctgcacgagcagcgcgaggtcttcgtcaccttctctgccggcgtcaccgcctggcgcccg
ggcgaggcgctcgaagccgcgctcgaacgcgccgacgaagcgctctacgaagccaagcgc
agcgggaagaaccgcacctgcaccgcctga

DBGET integrated database retrieval system