KEGG   Rubrivivax gelatinosus: RGE_19040Help
Entry
RGE_19040         CDS       T01803                                 

Gene name
glgB
Definition
putative 1,4-alpha-glucan-branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rge  Rubrivivax gelatinosus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RGE_19040 (glgB)
Enzymes [BR:rge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RGE_19040 (glgB)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_19040 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1986792..1988600)
Genome map
AA seq 602 aa AA seqDB search
MNVRHTASSVRPVVEGMGALPTPEGCAFRVWAPHAEAVFVAGDFNGFAPDAHALQPEADG
YWYGFVEEARTGHEYKYMIHHAGQQLFRIDPYARQVTSSVGNGVIYDHAAFDWGDDQPQI
RGHNELVIYELHVGSFFVREGEGRPGNFELALAKLDHLVKLGVNVVQVMPVAEFAGDYSW
GYNPAHVFAVESAYGGPDAFKTFVKACHQRGLAVVLDVVYNHFGPSDLDLWRFDGWSEND
KGGIYFYNDDRSSTPWGDTRPDYGREAVRRFIHDNAISWLRDFHLDGLRYDMTPYMRSVG
GNGHDIPDGWSLMRWINTSVREQFPGRILIAEDMQHLPEISQVGEHGAAFHAQWDSAFVH
PIREAAIVAADEHRDLHRVRDALQTRYNDDAFQRVIYTESHDEVANGRARVPADINPEDP
TGWHAQKRSTAAAALVFTAPGIPMIFQGQEFLQGGWFRDDVPLDWDHREQFRGTLRLYRD
LIALRRNLAGKTRGLQGQHIHVYHLNNDANVLAFQRWQDHGPGDDVVVVVNLGHEARSDY
RIGMPTGGRWTLLLNSDAPVYGPDFDGHEAQSVVAEDEPYDGFGASAVVNVGAYSVLIYA
LG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccgccacaccgcttcgtccgtccgccccgtcgtcgagggcatgggcgccttg
ccgacgcccgagggctgcgccttccgggtctgggcgccgcatgccgaggcggtgttcgtc
gccggcgacttcaacggcttcgcgcccgacgcgcacgcgctgcagcccgaggccgacggc
tactggtacggcttcgtcgaagaggcccgcaccggtcacgagtacaagtacatgatccac
cacgcgggccagcagctctttcgcatcgacccgtacgcgcgccaggtcacctcgtcggtc
ggcaacggcgtcatctacgaccacgccgccttcgactggggcgacgaccagccgcagatc
cgcggccacaacgagctggtgatctacgagctgcacgtcggctcgttcttcgtgcgcgag
ggcgagggccggccgggcaacttcgagctggcgctcgccaagctggaccacctcgtcaag
ctgggcgtcaacgtcgtgcaggtgatgccggtggccgagttcgccggcgactattcctgg
ggctacaacccggcgcacgtcttcgccgtcgagtcggcctacggtggccccgacgccttc
aagaccttcgtcaaggcctgccaccagcgtggcctggcggtggtgctggacgtggtctac
aaccacttcggcccgtcggacctggacctctggcgcttcgacggctggagcgagaacgac
aagggcggcatctacttctacaacgacgatcgttcgtccacgccctggggcgacacgcgc
cccgactacggccgcgaggcggtgcgccgcttcatccacgacaacgcgatctcgtggctg
cgcgacttccacctcgacggcctgcgctatgacatgacgccgtacatgcgcagcgtcggc
ggcaacggccacgacatccccgacggctggagcctgatgcgctggatcaacacctcggtg
cgcgagcagttcccgggccgcatcctgatcgccgaggacatgcagcacctgcccgagatc
tcacaggtgggcgagcacggcgccgccttccacgcgcaatgggacagcgccttcgtgcac
ccgatccgcgaggcggccatcgtcgccgccgacgaacaccgcgacctgcaccgcgtgcgc
gacgcgctgcagacgcgctacaacgacgacgccttccagcgcgtgatctacaccgagtcg
cacgacgaggtggccaacggccgcgcccgggtgccggcggacatcaaccccgaggacccg
accggctggcacgcgcagaagcgttccaccgcggccgccgcgctggtgttcacggcgccg
ggcatcccgatgatcttccagggccaggagttcctgcagggcggctggttccgcgacgac
gtgccgctggactgggaccaccgcgagcagttccgcggcaccctgcgcctgtaccgcgac
ctgatcgcgctgcggcgcaacctggcgggcaagacacgcggcctgcaaggccagcacatc
cacgtctaccacctgaacaacgacgccaacgtgctggccttccagcgctggcaggaccac
ggccccggcgacgacgtcgtcgtggtcgtcaacctcggccacgaggcgcgcagcgactac
cgcatcggcatgcccaccggcggccgctggacgctgctgctgaactccgacgcgccggtc
tacggcccggatttcgacggccacgaggcgcagtcggtggtcgcggaggacgagccctac
gacggcttcggcgccagcgcggtggtgaacgtcggggcctactcggtgctgatctacgcg
ctggggtga

DBGET integrated database retrieval system