KEGG   Rubrivivax gelatinosus: RGE_19210Help
Entry
RGE_19210         CDS       T01803                                 

Gene name
nosZ
Definition
(GenBank) nitrous oxide reductase, NosZ
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00910  Nitrogen metabolism
rge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RGE_19210 (nosZ)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RGE_19210 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2
Motif
Other DBs
NCBI-ProteinID: BAL95262
UniProt: I0HQH5
Position
complement(2006367..2008289)
Genome map
AA seq 640 aa AA seqDB search
MQHDKTPEAAADVPARRRFLNTAALSGLAVAVGACTDKSGAAGAAAPASAAAGSHAGAAN
ATHLAPGELDSYYGLWSGGHTGDMRVLGLPSGREIHRIPVFNPDALVGWGITNESKKVMG
TKPDGSLRYTVADTHHTHASYKDGNYDGRYAWINDKINARIARIRLDYFVCDKITQLPNV
QGFHGIFPDKRDPVDPAINYTTRVFCGGEFAIPLPNAGTEDGSKYRSIFSCVDAETMEVR
WQALIDGNCDLVATSYDGKLAATNQYNTEGGVHYEDMMSAERDACLFFHVARVEAAVKAG
KFKTIGDSKVPVVDATREANKDPKTALAGYVSVPKNPHGVNASPDGKYFICSGKLSPTGT
VIELAKVLDWFDGKLEKLDDVIVAEVELGLGPLHTAFDGRGNAYTTLFLDSQVVKWNVDA
AIKFHQGDKSAKYVVDRLDVHYQPGHLSATHSETAAADGKYLAVGCKFSKDRFLPVGPLH
PENEQFIDISGDKMVLLADHPVRGEPHDFIIFKRDIVKPKQVYSLDESPIAVKDPKESGV
TRNGRKVTVKLTSQAPAFSLREFKVKSGDEVTLILTNLDKVEDLTHGFAIPNHNVNFIVN
PQETKSVTFTAGKPGVYWCYCTHFCHALHLEMRTRMIVEA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgacaagacccccgaagccgcggccgacgtgccggcgcggcgccgcttcctg
aacaccgcggccctgtcgggcctggcggtggccgtcggcgcctgcaccgacaagagcggt
gccgccggtgccgccgcgccggcgtcggccgcggccggcagccatgccggtgccgccaac
gcgacgcacctcgccccgggcgaactcgactcctactacggcctctggagcggcggccac
accggcgacatgcgcgtgctgggcctgccttcgggtcgcgagatccaccgcatcccggtg
ttcaaccccgacgcgctggtcggctggggcatcaccaacgagtcgaagaaggtcatgggc
accaagcccgacggctcgctgcgctacacggtggccgacacccaccacacgcacgcctcg
tacaaggacggcaactacgacggccgctacgcgtggatcaacgacaagatcaacgcccgc
atcgcgcgcatccggctggactacttcgtctgcgacaagatcacgcagctgcccaacgtc
cagggcttccacggcatcttcccggacaagcgcgacccggtggacccggcgatcaactac
acgacgcgcgtgttctgcggcggcgagttcgcgatcccgctgcccaacgccggcaccgag
gacggctcgaagtaccgctcgatcttcagctgcgtcgacgccgagaccatggaagtgcgc
tggcaggcgctgatcgacggcaactgcgacctcgtcgccacctcgtacgacggcaagctc
gcggcgaccaaccagtacaacaccgaaggcggcgtgcactacgaggacatgatgtccgcc
gagcgcgacgcctgcctgttcttccacgtcgcgcgcgtcgaggcggcggtcaaggccggc
aagttcaagaccatcggcgacagcaaggtgccggtcgtcgacgccacgcgcgaagcgaac
aaggacccgaagaccgcgctcgccggctacgtctcggtgccgaagaacccgcacggtgtc
aacgcctcgcccgacggcaagtacttcatctgctcgggcaagctctcgcccaccggcacc
gtcatcgaactcgccaaggtgctggactggttcgacggcaagctcgagaagctcgacgac
gtcatcgtcgccgaggtcgagctgggcctgggccccctgcacaccgccttcgacggccgc
ggcaacgcctacaccacgctgttcctggacagccaggtcgtgaagtggaacgtcgacgcc
gcgatcaagttccaccagggcgacaagagcgccaagtacgtcgtcgaccgcctggacgtg
cactaccagccgggccacctgagcgccacgcacagcgagaccgcggccgccgacggcaag
tacctcgcggtgggctgcaagttcagcaaggaccgcttcctgccggtgggcccgctgcac
ccggagaacgagcagttcatcgacatctcgggcgacaagatggtgctgctggccgaccac
ccggtgcgtggcgagccgcacgacttcatcatcttcaagcgcgacatcgtcaagcccaag
caggtgtattcgctcgacgaatcgccgatcgcggtgaaggacccgaaggagtccggcgtc
acgcgcaacggcaggaaggtcaccgtcaagctcacctcgcaggcgccggcgttcagcctg
cgcgagttcaaggtgaagagcggcgacgaggtgacgctgatcctcaccaacctggacaag
gtcgaggacctgacgcacggcttcgcgatcccgaaccacaacgtcaacttcatcgtcaac
ccgcaggagacgaagtcggtgacgttcacggccggcaagccgggcgtgtactggtgctac
tgcacgcacttctgccatgcgctgcacctggagatgcgcacccgcatgatcgtcgaggcc
tag

DBGET integrated database retrieval system