KEGG   Rubrivivax gelatinosus: RGE_20600Help
Entry
RGE_20600         CDS       T01803                                 

Gene name
rocF
Definition
(GenBank) arginase RocF
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00220  Arginine biosynthesis
rge00330  Arginine and proline metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
rge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RGE_20600 (rocF)
   00330 Arginine and proline metabolism
    RGE_20600 (rocF)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RGE_20600 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAL95401
UniProt: I0HQW4
Position
2145052..2145864
Genome map
AA seq 270 aa AA seqDB search
MTFELTVFQGRVGDHNDLAIPGARRLAEAMGRLLALEPTVVGVPRPALDLNWDVELESAR
PELLQLQARFEDVYVRGGRPLSATSRCAASVATLPVVARHHPEACVVWFDAHADLNTPQS
TRSGYLGGLALSASLGLWDSGFGSGLALTNVVLVGQRDLDPFEIELMRAHCLPHVQPGAG
LADRLRAAIAGRPVYVHLDCDVLNPGIVPTDYAHEGGLSLDDLRQAMAVIAEQPVVGVEV
AEYQDAWAAGEPPVSPLPLLAALAPVLGLP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgaactcacggtcttccaaggtcgcgtcggcgaccacaacgatctggccatt
cccggggcgcgccggctcgccgaggcgatgggccggctgctggccctcgagccgaccgtc
gtcggcgtgccgcggccggccctcgacctgaactgggacgtcgaactcgagtccgcgcgg
cccgaactcttgcagctccaggcccggttcgaagacgtctacgtccgcggcgggcggccg
ctgtcggccaccagccgctgtgcggcctccgtcgccacgctgccggtcgtcgcacggcac
catcccgaggcctgcgtcgtctggttcgacgcccacgcggacctcaacacgccgcagtcg
acgcgcagcggctacctcggcgggctggccttgtccgcgtcgctgggactgtgggactcc
ggcttcggcagcggcttggcgctgacgaacgtcgtgctcgtcggccagcgcgacctcgat
ccgttcgagatcgaactgatgcgcgcgcattgcctgcctcacgtccagccgggcgctggc
ctggccgatcggctgcgcgccgcgatcgccggccgcccggtctacgtccacttggactgc
gacgtgctgaaccccggcatcgtgccgaccgactacgcccacgagggcggcctgtcgctg
gacgacttgcggcaggcgatggcggtcatcgccgagcagccggtcgtcggcgtcgaagtg
gcggagtatcaggacgcgtgggcagcgggtgaaccgccggtgtcgcctttgcccttgctg
gccgccttggccccggttctgggcctgccgtag

DBGET integrated database retrieval system