KEGG   Rubrivivax gelatinosus: RGE_20920Help
Entry
RGE_20920         CDS       T01803                                 

Gene name
mtnD
Definition
putative acireductone dioxygenase (Ni2+ or Fe2+-requiring) MtnD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rge  Rubrivivax gelatinosus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rge00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177940..2178494
Genome map
AA seq 184 aa AA seqDB search
MQAWLFDEDGGVREHARGTAAGVALLARLGVDAGRVEIEPDADSGHHAALDALRRHYGIV
HEDRVTVRPGDPAWPPLRARFLEEHTHADLELRVFVNGRGLFHVRLPAGGLAVLCSAGDW
IAVPAGLAHRFDGGRLADFEALRFFSRAQGWEAMPTGAGAPTLPLLDELLAGRVTAPPAV
ARLA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctggctcttcgacgaagacggcggcgtgcgcgagcacgcacgcggcacggcc
gccggcgtggcgctgctggcgcgcctgggcgtggacgccgggcgcgtggagatcgagccc
gacgccgactcgggccaccacgcggcgctggacgcgctgcgccggcactacggcatcgtg
cacgaggaccgcgtcacggtgcgcccgggcgacccggcctggccgccgctgcgcgcgcgt
ttcctcgaggagcacacgcacgccgacctggagctgcgcgtgttcgtcaacggccgtggc
ctgttccacgtgcgcctgccggcgggcggcctggccgtgctgtgcagcgccggcgactgg
atcgccgtgccggcgggtctggcccaccgcttcgacggcggccgcctggccgacttcgag
gcgctgcgtttcttctcgcgtgcccagggctgggaggcaatgcccaccggcgccggcgcg
ccgacgctgccgctgctcgacgagctgctggccgggcgcgtgaccgcgccgccggccgtc
gcgaggcttgcatga

DBGET integrated database retrieval system