KEGG   Rubrivivax gelatinosus: RGE_20920Help
Entry
RGE_20920         CDS       T01803                                 

Gene name
mtnD
Definition
putative acireductone dioxygenase (Ni2+ or Fe2+-requiring) MtnD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rge  Rubrivivax gelatinosus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RGE_20920 (mtnD)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     RGE_20920 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     RGE_20920 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177940..2178494
Genome map
AA seq 184 aa AA seqDB search
MQAWLFDEDGGVREHARGTAAGVALLARLGVDAGRVEIEPDADSGHHAALDALRRHYGIV
HEDRVTVRPGDPAWPPLRARFLEEHTHADLELRVFVNGRGLFHVRLPAGGLAVLCSAGDW
IAVPAGLAHRFDGGRLADFEALRFFSRAQGWEAMPTGAGAPTLPLLDELLAGRVTAPPAV
ARLA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctggctcttcgacgaagacggcggcgtgcgcgagcacgcacgcggcacggcc
gccggcgtggcgctgctggcgcgcctgggcgtggacgccgggcgcgtggagatcgagccc
gacgccgactcgggccaccacgcggcgctggacgcgctgcgccggcactacggcatcgtg
cacgaggaccgcgtcacggtgcgcccgggcgacccggcctggccgccgctgcgcgcgcgt
ttcctcgaggagcacacgcacgccgacctggagctgcgcgtgttcgtcaacggccgtggc
ctgttccacgtgcgcctgccggcgggcggcctggccgtgctgtgcagcgccggcgactgg
atcgccgtgccggcgggtctggcccaccgcttcgacggcggccgcctggccgacttcgag
gcgctgcgtttcttctcgcgtgcccagggctgggaggcaatgcccaccggcgccggcgcg
ccgacgctgccgctgctcgacgagctgctggccgggcgcgtgaccgcgccgccggccgtc
gcgaggcttgcatga

DBGET integrated database retrieval system