KEGG   Rubrivivax gelatinosus: RGE_24150Help
Entry
RGE_24150         CDS       T01803                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rge  Rubrivivax gelatinosus
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rge01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2546502..2547146)
Genome map
AA seq 214 aa AA seqDB search
MRWTRRQWLAHASALAVTPAFAGPAAAADARTLLVLGDSLSAEYGLARGSGWVSLLDKRL
GDQAPGWKLVNASISGETTSGGRTRLPALLKQHKPGLVILELGGNDALRGLPIANTRDNL
ATMARSAREAGAKVVVVGMEVPPNYGRRYAEDFSASFAKVARESGAALVPFLLRGVADVP
EAETLFQADRIHPTAQAQPTMLDNVWPVLKPLLR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggacccgccggcaatggctggcgcatgctagcgcgctcgccgtcaccccggcg
ttcgcgggcccggcggcagcggccgacgcgcgcaccttgctcgtgctcggcgacagcctg
tcggccgagtacggcctggcgcgcggcagcggctgggtctcgctgctggacaagcgcctg
ggcgaccaggcgccgggctggaaactcgtcaacgccagcatcagcggcgagacgacctcc
ggcgggcgcacgcggctgccggcgctgctcaagcagcacaagcccgggctggtgatcctg
gaactcggcggcaacgacgcgctgcgcggcctgcccatcgccaacacgcgcgacaacctg
gcgacgatggcgcgcagcgcgcgcgaggccggcgccaaggtcgtcgtcgtcggcatggaa
gtgccgccgaactacggccggcgctacgccgaggacttctcggcctcgttcgccaaggtc
gcgcgcgaaagcggcgcggcgctcgtgccctttttgctgcgcggcgtcgccgacgtgccc
gaggccgagacgctgttccaggccgaccgcatccacccgaccgcgcaggcccagccgacg
atgctcgacaacgtctggccggtgctcaagccgctgctgcgctga

DBGET integrated database retrieval system