KEGG   Rubrivivax gelatinosus: RGE_24150Help
Entry
RGE_24150         CDS       T01803                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rge  Rubrivivax gelatinosus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RGE_24150
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RGE_24150
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RGE_24150
Lipid biosynthesis proteins [BR:rge01004]
 Fatty acid synthase
  Component type
   RGE_24150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2546502..2547146)
Genome map
AA seq 214 aa AA seqDB search
MRWTRRQWLAHASALAVTPAFAGPAAAADARTLLVLGDSLSAEYGLARGSGWVSLLDKRL
GDQAPGWKLVNASISGETTSGGRTRLPALLKQHKPGLVILELGGNDALRGLPIANTRDNL
ATMARSAREAGAKVVVVGMEVPPNYGRRYAEDFSASFAKVARESGAALVPFLLRGVADVP
EAETLFQADRIHPTAQAQPTMLDNVWPVLKPLLR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggacccgccggcaatggctggcgcatgctagcgcgctcgccgtcaccccggcg
ttcgcgggcccggcggcagcggccgacgcgcgcaccttgctcgtgctcggcgacagcctg
tcggccgagtacggcctggcgcgcggcagcggctgggtctcgctgctggacaagcgcctg
ggcgaccaggcgccgggctggaaactcgtcaacgccagcatcagcggcgagacgacctcc
ggcgggcgcacgcggctgccggcgctgctcaagcagcacaagcccgggctggtgatcctg
gaactcggcggcaacgacgcgctgcgcggcctgcccatcgccaacacgcgcgacaacctg
gcgacgatggcgcgcagcgcgcgcgaggccggcgccaaggtcgtcgtcgtcggcatggaa
gtgccgccgaactacggccggcgctacgccgaggacttctcggcctcgttcgccaaggtc
gcgcgcgaaagcggcgcggcgctcgtgccctttttgctgcgcggcgtcgccgacgtgccc
gaggccgagacgctgttccaggccgaccgcatccacccgaccgcgcaggcccagccgacg
atgctcgacaacgtctggccggtgctcaagccgctgctgcgctga

DBGET integrated database retrieval system