KEGG   Rubrivivax gelatinosus: RGE_26190Help
Entry
RGE_26190         CDS       T01803                                 

Gene name
speB
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rge  Rubrivivax gelatinosus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RGE_26190 (speB)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RGE_26190 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2760973..2761953
Genome map
AA seq 326 aa AA seqDB search
MRVPPARPMSHFAFLSDHASFLKVPTREAAPAMPFCVAGVAWDGAVTNRPGARFGPRAIR
AASHMLCDATHPLFGSSPIGALADAGDLPLPNTSIEGMRRALQPAAAELIAAHHMAWLGG
DHSMTLPLLREYRARFGRPLAVIHFDAHCDTWEDHFGEPSGHGTWVHEAFVEGLVDPACF
VQVGIRSAAVREARDYVPDRGGLFFGARELRGLESPGQLAPVLAAVRERFAAHGMPPVYL
SLDIDCLDPAFAPGTGTPEPGGMSTNQVLTLLEEWAELPFVGMDCVEVAPPYDHAELASS
AAATFVWTYLAGRLAQAAAGAGAARR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgccgcccgcccgaccgatgagccacttcgccttcctttccgaccacgcctcg
ttcctcaaggtgccgacgcgcgaggccgccccggcaatgccgttctgcgtcgccggcgtc
gcctgggacggcgcggtgaccaaccgccccggtgcacgcttcgggccacgcgcgatccgc
gccgccagccacatgctctgcgacgcgacgcacccgctgttcggcagctcgccgatcggc
gcgctggccgacgccggcgacctgccgctgcccaacacctcgatcgagggcatgcggcgt
gcgctgcagcccgcggccgccgagctgatcgccgcgcaccacatggcctggctgggcggc
gaccactcgatgacgctgccgctgctgcgcgagtaccgcgcccgcttcggccggccgctg
gcggtgatccacttcgacgcccactgcgacacctgggaagaccatttcggcgagccctcg
ggccatggcacctgggtgcacgaggccttcgtcgaggggctggtcgatccggcgtgtttc
gtccaggtcggcatccgctcggcggcggtgcgcgaggcgcgcgactacgtgcccgaccgc
ggcggcctgttcttcggcgcccgcgaactgcgcggcctggagagcccgggccagctcgcg
ccggtgctggccgcggtgcgcgagcgtttcgccgcgcacggcatgccgccggtctatctg
tcgctggacatcgactgcctggacccggctttcgcgccgggcaccggcaccccggaaccg
ggcggcatgagcaccaaccaggtgctgaccctgctcgaagagtgggcggagctgcctttc
gtcggcatggattgcgtcgaagtcgcgccgccgtacgatcatgcggaactcgcctcgtcg
gcggccgccaccttcgtctggacttacctggccgggcgcctcgcgcaggccgcagcggga
gcaggggcggcgcgccgctga

DBGET integrated database retrieval system