KEGG   Rubrivivax gelatinosus: RGE_26360Help
Entry
RGE_26360         CDS       T01803                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rge  Rubrivivax gelatinosus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RGE_26360
Enzymes [BR:rge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RGE_26360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2779216..2779878)
Genome map
AA seq 220 aa AA seqDB search
MNVPFVEVAAREDAAAAVRLLDARGLNRGSTGNLSVRCGDAMLITPTGMGSEVCGEDFVR
VFLADGRVEGTWQPSSEWHFHQAVYRARPDLNAVVHTHSPNATALACLDRPLPAFHYMIA
VAGGDTVPLVPYHTFGTEALSAAVGEAMAERKACLLAHHGLVAAGATLAEAMKVCQEIES
LCEVYLKALAVAEPRVLGHAEMDEVIAKFRSYGRSARRDA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcccttcgtcgaggtcgccgcacgcgaggacgccgccgccgcggtgcgcctg
ctggacgcgcgtggcctcaaccgcggcagcaccggcaacctcagcgtgcgctgcggcgac
gcgatgctgatcacgccgaccggcatgggttcggaagtctgcggcgaggacttcgtgcgt
gtcttcctcgccgacggtcgtgtcgaaggcacctggcagccgtcgtcggaatggcatttc
caccaggcggtctaccgcgcccggccggacctgaacgccgtcgtgcacacgcattcgccg
aacgccaccgcgctggcctgcctggaccggccgctgccggccttccactacatgatcgcg
gtggccggcggcgacacggtgccgctggtgccgtaccacaccttcggcaccgaggcgctg
tcggcggccgtcggcgaggcgatggccgagcgcaaggcctgcctgctggcgcaccatggc
ctggtggccgccggcgcgacgctggccgaggcgatgaaggtctgccaggagatcgagtcg
ctgtgcgaggtctacctgaaggcgctggcggtggccgagccgcgcgtgctgggccatgcc
gagatggacgaggtgatcgccaagttcaggagctacggccgcagcgcccgccgcgacgcg
tag

DBGET integrated database retrieval system