KEGG   Rubrivivax gelatinosus: RGE_26860Help
Entry
RGE_26860         CDS       T01803                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rge  Rubrivivax gelatinosus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RGE_26860 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RGE_26860 (bdhA)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RGE_26860 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2840212..2840985
Genome map
AA seq 257 aa AA seqDB search
MLQGKTALVTGSTSGIGLGMAVALAQQGAKLMLNGFGDVDAALQTVRAAGSGEVAYHGAD
MRRPDEIEDLVHQCERQFGGPDIVVNNAGIQHVALVEDFPVERWDAIIAINLSSAFHTMR
VALPGMKHRGWGRVINVASVHGLVASAGKSAYVAAKHGIVGLTRAAALECARSGVTVNAI
CPGWVLTPLVQKQIDARAAEHGLSNEEAERQLLAEKEPSLRFTTPEQLAALALFLCSPAG
DNVLGTAWNMDGGWTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaggaaagacggcgctggtgacgggctcgacgagcggcatcggcctcggcatg
gcggtggcgctcgcgcagcagggtgcgaagctgatgctcaacggcttcggcgacgtcgac
gccgcgctgcagacggtgcgcgccgccggctccggcgaagtcgcctaccacggcgccgac
atgcgccggcccgacgagatcgaggatctggtgcaccagtgcgagcgccagttcggcggc
ccggacatcgtcgtcaacaacgccggcatccagcacgtcgcgctggtcgaggatttcccg
gtcgagcgctgggacgcgatcatcgcgatcaacctcagctcggccttccacacgatgcgt
gtggcgctgccgggcatgaagcatcgcggctgggggcgcgtcatcaacgtcgcctcggtg
cacgggctggtggcctcggccggcaagagcgcctacgtcgcggccaaacacggcatcgtc
gggctgacgcgtgccgcggcgctggaatgcgcacgcagcggcgtcaccgtcaacgcgatc
tgccccggctgggtgctgacgccgctggtgcaaaagcagatcgacgcccgcgccgccgag
cacgggctgtcgaacgaggaagccgagcgccagctgctggccgagaaggagccttcgctg
cgcttcacgacgcccgagcaactggcggcgctggcgctgttcctgtgttcgccggccggt
gacaacgtgctcggcacggcctggaacatggacggcggctggacggcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system