KEGG   Rubrivivax gelatinosus: RGE_26940Help
Entry
RGE_26940         CDS       T01803                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_26940
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_26940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RGE_26940
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RGE_26940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2849504..2850862
Genome map
AA seq 452 aa AA seqDB search
MTTKFLLEESRMPRHWYNIVADLPVPPAPPLHPATKQPVAPADLEPLFTRSLIEQEMATE
REIEIPEPIREVFRLWRPAPLIRARRLEQALQTPAKIFFKYEGVSPAGSHKPNSAVPQAW
YNAQAGIRKLSTETGAGQWGSSLAFAGALFGLEVKVFQVRVSYDQKPYRRALMETYGATC
IPSPSPETAAGRAALAERPDHPGSLGLAISEAVEVAATNDDTKYALGSVLNHVLLHQTII
GQEAMLQMEMADADPDVVIACTGGGSNFAGLAFPYVGQTLRGGRRRRIVAVEPAACPSLT
RGKFAYDFGDTAHLTPLTKMHTLGSTFTPPGFHAGGLRYHGMAPLVSHLKELGLIEAQAH
TQNDCFAAAVLFARCEGIVPAPEASHAIQGAVAEALRCKAEGKAETILFGLSGHGHFDMA
AYTNYLGGKLVDASYDEAELAMALSGLPSIPA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagttcctgctcgaagaaagccgcatgccgcggcactggtacaacatcgtg
gccgacctgccggtgccaccggcgccgccgctgcacccggccaccaagcagcccgtcgcg
ccggccgacctggagccgctgttcacgcgctcgctgatcgagcaggagatggcgaccgag
cgcgagatcgagatccccgagccgatccgcgaagtcttccgcctctggcgcccggcgccg
ctgatccgcgcccgccgcctcgagcaggcgctgcagacgccggccaagatcttcttcaag
tacgaaggcgtgtcgccggcgggcagccacaagcccaacagcgccgtgccgcaggcctgg
tacaacgcccaggccggcatccgcaagctgagcaccgagaccggcgccggccagtggggc
tcgtcgctggccttcgccggcgcgctgttcgggctggaggtcaaggtcttccaggtgcgc
gtgtcctacgaccagaaaccgtaccgccgcgcgctgatggagacctacggcgccacctgc
atcccctcgccttcgcccgagaccgccgccggccgtgccgcgctggccgagcgcccggac
caccccggctcgctgggcctggcgatcagcgaggccgtcgaggtcgcggcgacgaacgac
gacaccaagtacgcgctgggctcggtgctcaaccacgtgctgctgcaccagaccatcatc
ggccaggaagcgatgctgcagatggagatggccgacgccgacccggacgtggtcatcgcc
tgcaccggcggcggcagcaacttcgccgggctggccttcccctacgtcggccagacgctg
cgcggcggccgccggcgccgcatcgtcgccgtcgagccggccgcctgcccgagcctgact
cgcggcaagttcgcctacgacttcggcgacaccgcgcacctgacgccgctgaccaagatg
cacacgctgggcagcaccttcacgccgccgggcttccacgccggcggcctgcgctaccac
ggcatggcgccgctggtcagccacctgaaggagctcggcctgatcgaggcccaggcgcac
acccagaacgactgcttcgccgcggcggtgctgttcgcgcgctgcgaaggcatcgtgccg
gcccccgaggccagccacgcgatccagggcgcggtggccgaggcgctgcgctgcaaggcc
gaaggcaaggccgagaccatcctcttcggcctgagcggccacggccacttcgacatggcc
gcctacaccaactacctcggcggcaagctggtcgacgccagctacgacgaggccgagctg
gcgatggcgctgtcggggctgccgtcgatcccggcctga

DBGET integrated database retrieval system