KEGG   Rubrivivax gelatinosus: RGE_27740Help
Entry
RGE_27740         CDS       T01803                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component OdhB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00020  Citrate cycle (TCA cycle)
rge00310  Lysine degradation
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Module
rge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_27740 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    RGE_27740 (odhB)
Enzymes [BR:rge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RGE_27740 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAL96113
UniProt: I0HSX6
Position
complement(2936744..2938006)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGDAVAADEILIEIETDKVVLEVPAPAAGVLAEL
VEADGATVASDQLIAKIDTEAKAGTAAPAAAAPAPAAAAPAPAAPAPAAGGSKAGVAMPA
AAKLMADNQLAAGSVPGTGKDGRVTKGDVLGALAAPKAAAPAPVAAPAAPAVAKPLPPVA
APAVNLGERPEQRVPMSRLRARVAERLLQSQATNAILTTFNEVNMAPVMEMRKRFQERFE
KEHGVKLGFMSFFVKAAVAALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADVEKKIAEYGTKARDGKLSIEELSGGTFSISNGGVFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgttgaagtgaaggtcccgcaactgtccgaatcggtcgcggaagccaccctg
ctgcaatggaagaagaagcccggcgacgccgtcgccgccgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaagtgccggcgccggccgccggcgtgctggccgaactc
gtcgaggccgacggcgccaccgtcgccagcgaccagttgatcgcgaagatcgacaccgag
gccaaggctggcaccgccgcgcccgcagcagccgctccggcgcctgccgccgccgccccg
gcgccggctgccccggcccccgccgcaggcggctccaaggccggcgtcgcgatgcccgcg
gcggccaagctgatggccgacaaccagctggccgccggctcggtgccgggcaccggcaag
gacggccgcgtcaccaagggcgacgtgctcggcgcgctggccgcgcccaaggccgcggcg
ccggcgcccgtcgccgcgccggccgctccggccgtcgccaagccgctgccgccggtggcc
gcgcccgcggtcaacctcggcgagcgccccgaacagcgtgtgccgatgtcgcgcctgcgc
gcccgcgtcgccgagcgcctgctgcagtcgcaggccaccaacgccatcctgacgaccttc
aacgaggtcaacatggcgccggtgatggagatgcgcaagcgcttccaggagcgcttcgag
aaggaacacggcgtcaagctcggcttcatgtccttcttcgtcaaggccgcggtcgcggcg
ctgaagaagtacccggtgctcaacgcctcggtcgacggcaacgacatcgtctaccacggc
tacttcgacatcggcatcgccgtcggctcgccgcgcggcctggtcgtgccgatcctgcgc
aacgccgaccagatgtcgtttgccgacgtcgagaagaagatcgccgagtacggcaccaag
gcccgcgacggcaagctgtcgatcgaggagctctccggcggcaccttctcgatcagcaac
ggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagagcgcgatc
ctcggcgtgcacgcgaccaaggaccgcgccgtcgtcgagaacggccagatcgtcatccgc
ccgatcaactacctggcgatgtcctacgaccaccgcatcatcgacggccgcgaggccgtg
ctcggcctggtggcgatgaaggaagcgctggaagacccgtcgcgcctgctgttcgacatc
tga

DBGET integrated database retrieval system