KEGG   Rubrivivax gelatinosus: RGE_27740Help
Entry
RGE_27740         CDS       T01803                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase E2 component OdhB (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rge  Rubrivivax gelatinosus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_27740 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_27740 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    RGE_27740 (odhB)
Enzymes [BR:rge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RGE_27740 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2936744..2938006)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGDAVAADEILIEIETDKVVLEVPAPAAGVLAEL
VEADGATVASDQLIAKIDTEAKAGTAAPAAAAPAPAAAAPAPAAPAPAAGGSKAGVAMPA
AAKLMADNQLAAGSVPGTGKDGRVTKGDVLGALAAPKAAAPAPVAAPAAPAVAKPLPPVA
APAVNLGERPEQRVPMSRLRARVAERLLQSQATNAILTTFNEVNMAPVMEMRKRFQERFE
KEHGVKLGFMSFFVKAAVAALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADVEKKIAEYGTKARDGKLSIEELSGGTFSISNGGVFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgttgaagtgaaggtcccgcaactgtccgaatcggtcgcggaagccaccctg
ctgcaatggaagaagaagcccggcgacgccgtcgccgccgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaagtgccggcgccggccgccggcgtgctggccgaactc
gtcgaggccgacggcgccaccgtcgccagcgaccagttgatcgcgaagatcgacaccgag
gccaaggctggcaccgccgcgcccgcagcagccgctccggcgcctgccgccgccgccccg
gcgccggctgccccggcccccgccgcaggcggctccaaggccggcgtcgcgatgcccgcg
gcggccaagctgatggccgacaaccagctggccgccggctcggtgccgggcaccggcaag
gacggccgcgtcaccaagggcgacgtgctcggcgcgctggccgcgcccaaggccgcggcg
ccggcgcccgtcgccgcgccggccgctccggccgtcgccaagccgctgccgccggtggcc
gcgcccgcggtcaacctcggcgagcgccccgaacagcgtgtgccgatgtcgcgcctgcgc
gcccgcgtcgccgagcgcctgctgcagtcgcaggccaccaacgccatcctgacgaccttc
aacgaggtcaacatggcgccggtgatggagatgcgcaagcgcttccaggagcgcttcgag
aaggaacacggcgtcaagctcggcttcatgtccttcttcgtcaaggccgcggtcgcggcg
ctgaagaagtacccggtgctcaacgcctcggtcgacggcaacgacatcgtctaccacggc
tacttcgacatcggcatcgccgtcggctcgccgcgcggcctggtcgtgccgatcctgcgc
aacgccgaccagatgtcgtttgccgacgtcgagaagaagatcgccgagtacggcaccaag
gcccgcgacggcaagctgtcgatcgaggagctctccggcggcaccttctcgatcagcaac
ggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagagcgcgatc
ctcggcgtgcacgcgaccaaggaccgcgccgtcgtcgagaacggccagatcgtcatccgc
ccgatcaactacctggcgatgtcctacgaccaccgcatcatcgacggccgcgaggccgtg
ctcggcctggtggcgatgaaggaagcgctggaagacccgtcgcgcctgctgttcgacatc
tga

DBGET integrated database retrieval system