KEGG   Rubrivivax gelatinosus: RGE_28650Help
Entry
RGE_28650         CDS       T01803                                 

Gene name
porC
Definition
(GenBank) pyruvate ferredoxin oxidoreductase gamma subunit PorC (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_28650 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_28650 (porC)
   00020 Citrate cycle (TCA cycle)
    RGE_28650 (porC)
   00620 Pyruvate metabolism
    RGE_28650 (porC)
   00640 Propanoate metabolism
    RGE_28650 (porC)
   00650 Butanoate metabolism
    RGE_28650 (porC)
  Energy metabolism
   00680 Methane metabolism
    RGE_28650 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RGE_28650 (porC)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RGE_28650 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3034687..3035268
Genome map
AA seq 193 aa AA seqDB search
MLQIRLHGRGGQGTVTAAEMLSLAAFEQGRHAQAFPSFGSERTGAPVVAFCRIGDCEIRS
REPVMAPDVLVVQDPTLLHQVDVFQGLKPDGWVLINSGRDLAALGLAELAARLPPGHAAT
VPASEIALARLGRPLPNAALLGGLAALAGIVSLEAVAQAIRDTFAGRVADANILAAADAH
AWVLEHAEGAAAC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagatccggctgcacgggcgcggcggccaaggcacggtgacggcagccgagatg
ctgtcgctcgcggccttcgagcagggccgccacgcccaggccttccccagcttcggctcc
gagcgcaccggcgcaccggtcgtcgccttctgccgcatcggcgactgcgagatccgatcg
cgcgagccggtgatggcgcccgacgtgctcgtcgtgcaggacccgacgctgctgcaccag
gtcgacgtcttccagggcctcaagcccgacggctgggtgctgatcaactccggccgcgac
ctcgccgcgctgggcctggccgagctggccgcgcggctgccgccgggccacgccgccacc
gtgccggccagcgagatcgcgctggcgcgcctcgggcggccgctgcccaacgccgcgctg
ctgggcgggctggcggcgctggccggcatcgtctcgctggaggcggtggcgcaggccatc
cgcgacaccttcgccggccgcgtggccgacgccaacatcctcgccgccgccgacgcccat
gcctgggtgctggagcacgccgaaggagccgccgcatgctga

DBGET integrated database retrieval system