KEGG   Rubrivivax gelatinosus: RGE_28650Help
Entry
RGE_28650         CDS       T01803                                 

Gene name
porC
Definition
pyruvate ferredoxin oxidoreductase gamma subunit PorC (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rge01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rge00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rge00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rge00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rge00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rge00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rge00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:rge00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3034687..3035268
Genome map
AA seq 193 aa AA seqDB search
MLQIRLHGRGGQGTVTAAEMLSLAAFEQGRHAQAFPSFGSERTGAPVVAFCRIGDCEIRS
REPVMAPDVLVVQDPTLLHQVDVFQGLKPDGWVLINSGRDLAALGLAELAARLPPGHAAT
VPASEIALARLGRPLPNAALLGGLAALAGIVSLEAVAQAIRDTFAGRVADANILAAADAH
AWVLEHAEGAAAC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagatccggctgcacgggcgcggcggccaaggcacggtgacggcagccgagatg
ctgtcgctcgcggccttcgagcagggccgccacgcccaggccttccccagcttcggctcc
gagcgcaccggcgcaccggtcgtcgccttctgccgcatcggcgactgcgagatccgatcg
cgcgagccggtgatggcgcccgacgtgctcgtcgtgcaggacccgacgctgctgcaccag
gtcgacgtcttccagggcctcaagcccgacggctgggtgctgatcaactccggccgcgac
ctcgccgcgctgggcctggccgagctggccgcgcggctgccgccgggccacgccgccacc
gtgccggccagcgagatcgcgctggcgcgcctcgggcggccgctgcccaacgccgcgctg
ctgggcgggctggcggcgctggccggcatcgtctcgctggaggcggtggcgcaggccatc
cgcgacaccttcgccggccgcgtggccgacgccaacatcctcgccgccgccgacgcccat
gcctgggtgctggagcacgccgaaggagccgccgcatgctga

DBGET integrated database retrieval system