KEGG   Rubrivivax gelatinosus: RGE_28660Help
Entry
RGE_28660         CDS       T01803                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase alpha subunit PorA
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_28660 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_28660 (porA)
   00020 Citrate cycle (TCA cycle)
    RGE_28660 (porA)
   00620 Pyruvate metabolism
    RGE_28660 (porA)
   00640 Propanoate metabolism
    RGE_28660 (porA)
   00650 Butanoate metabolism
    RGE_28660 (porA)
  Energy metabolism
   00680 Methane metabolism
    RGE_28660 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RGE_28660 (porA)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RGE_28660 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3035262..3036515
Genome map
AA seq 417 aa AA seqDB search
MLKQIEGSRAVAQAVALARPEVICAYPISPQTHIVEGLGELVKDGSLSPCEFVNVESEFA
AMSVAIGASAAGARSYTATASQGLLFMAEAVYNASGLGLPIVMTVANRAIGAPINIWNDH
SDSMSQRDCGWIQLFAETNQEAADLHLQAFKLGEELSMPVMVCMDGFILTHAVERVDLPT
QAEVDAFLPPYEPRQVLDPAEPVSIGAMVGPEAFMEVRYIAHAKQTMALERIPQIAAEFQ
ARFGRDSGGLVRGYRLDGAKTVVVALGSVLGTLKDAVDVLRDDGMAVGVLGIGSFRPFPL
AAVRAALEGAERVVVLEKSFSVGLGGVVSTDVRLALSGLVLHGHTVVAGLGGRAITQASL
ERMLRDAVAGKLGPITFLDLDWRIVERQLAREAAVRRSGPIAENLLRDLGAAAPRGS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcagatcgaaggctcgcgcgccgtcgcgcaggcggtggcgctggcccgcccc
gaggtcatctgcgcctacccgatctcgccgcagacgcacatcgtcgagggcctgggcgag
ctggtgaaggacggcagcctcagcccttgcgagtttgtcaacgtcgagagcgagttcgcg
gcgatgagcgtggccatcggcgccagcgccgccggcgcacgcagctacaccgccaccgcc
agccagggcctgctgttcatggccgaggcggtctacaacgcctcgggcctggggctgccg
atcgtcatgacggtggccaaccgcgcgatcggcgcgccgatcaacatctggaacgaccac
agcgactcgatgagccagcgcgactgcggctggatccagctcttcgccgagaccaaccag
gaggccgccgacctgcacctgcaggccttcaagctcggcgaggagctgtcgatgccggtg
atggtctgcatggacggcttcatcctgacccacgccgtcgagcgtgtggacctgccgacg
caggccgaggtcgacgccttcctgccgccttacgagccgcgccaggtgctggacccggcc
gagccggtgtcgatcggcgcgatggtcggcccggaggccttcatggaggtgcgctacatc
gcccacgccaagcagacgatggcgctggagcgcatcccgcagatcgccgccgagttccag
gcgcgtttcggccgcgactcgggcggtctggtgcgcggctaccggctggacggcgcgaaa
accgtcgtcgtcgcgctcggctcggtgctgggcacgctgaaggacgcggtcgacgtgctg
cgcgacgacggcatggcggtcggcgtgctcggcatcggctcgttccggcccttcccgctg
gccgcggtgcgtgccgcgctcgaaggcgccgagcgggtcgtcgtgctggagaagagcttc
tcggtcgggctgggcggcgtcgtctccaccgacgtgcgactggcgctgtcggggctcgtc
ctgcacggccacacggtggtcgccgggctgggcgggcgggcgatcacgcaggcctcgctg
gagcgcatgctgcgcgacgcggtggccggcaagctcgggccgatcaccttcctggacctg
gactggcgcatcgtcgagcgccagctggcacgcgaggccgcggtgcgccgcagcggcccg
atcgccgagaacctgctgcgcgacctgggcgccgccgcgccgcgcgggagctga

DBGET integrated database retrieval system