KEGG   Rubrivivax gelatinosus: RGE_29110Help
Entry
RGE_29110         CDS       T01803                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rge  Rubrivivax gelatinosus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RGE_29110 (malQ)
Enzymes [BR:rge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RGE_29110 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3086275..3087774
Genome map
AA seq 499 aa AA seqDB search
MRLPRSSGILLHPTSLPGPHGSGDLGPAAYHFVDWLASAGQRLWQVLPLGGIGPGNSPYM
SPSAFAGNVLLIDLGELQSQGWLDAADLEPAPGLFATHVDYGAVTSFRMERLARAAARFA
ASASEESRAAFDTFCESHRSWLDDYALFMALSEAHEGVDWCDWAPGLALRRAGALATAHR
THAERVAFWRFCQWSFFRQWAQLRAYAARKGVKIVGDAPIFIAHHSADVWARPELFELDP
EGRPTVVAGVPPDFFSATGQRWGNPLYRWSAHAAEGYAWWIERLRRTFELVDIVRIDHFR
GFAAHWEIPASEPTAVNGRWVPGPGAALFEAVQQALGTLPVLAEDLGVITPDVEALRRRF
EFPGMLILQFAFGGDAANRYLPHHHEHDAVVYTGTHDNDTVAGWWAGASDTERHFARGYF
GVDGHDMPWTLIRAACMSIADTAIHPLQDVLCLGGEHRMNRPGADDGCWRWRFQWNDVHP
WHGRRLAEFCRLYGRTPAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccccgttcgagcgggatcctgctgcaccccacctcgctgccgggcccgcac
ggctcgggcgacctgggcccggcggcctatcacttcgtcgactggctggccagcgccggc
cagcgtctgtggcaggtgctgccgctggggggcatcggccccggcaactcgccctacatg
agcccgtcggccttcgccggcaacgtgctgctgatcgacctgggcgagctccagagccag
ggctggctggacgccgccgacctcgagcccgcgcctggcctgttcgccacccacgtcgac
tacggggccgtcaccagcttccgcatggagcggctggcgcgcgccgcggcccgtttcgcc
gcgtcggccagcgaggagtcgcgcgccgccttcgacaccttctgcgagtcgcaccgcagc
tggctcgacgattacgcgctgttcatggcgctgtccgaggcgcacgaaggcgtcgactgg
tgcgactgggcgccgggcctggcgctgcgccgcgccggcgcgctggccaccgcccaccgc
acgcacgccgagcgcgtcgccttctggcgcttctgccagtggagcttcttccggcagtgg
gcgcagctgcgcgcctacgccgcgcgcaagggcgtgaagatcgtcggcgacgcgccgatc
ttcatcgcccaccacagcgccgacgtctgggcccgcccggagctcttcgagctcgacccc
gagggccggccgaccgtcgtcgccggcgtgccgccggacttcttcagcgccacaggccag
cgttggggcaacccgctgtaccgctggagcgcgcacgccgccgagggctacgcctggtgg
atcgaacgcctgcgccgcactttcgagctcgtcgacatcgtgcgcatcgaccatttccgc
ggcttcgcggcgcactgggagatcccggcctcggagccgacggcggtcaacggccgctgg
gtgcccggccccggcgcggcgctgttcgaggccgtgcagcaggcgctgggcacgctgccg
gtgctggccgaggacctgggcgtcatcacgcccgacgtcgaggcgctgcgccggcgtttc
gagttccccggcatgctgatcctgcagttcgccttcggcggcgacgccgccaaccgctac
ctgccacaccaccacgagcacgacgccgtggtctacaccggcacgcacgacaacgacacg
gtggccggctggtgggccggggcttcggacaccgagcgccacttcgcgcgcggctacttc
ggcgtcgacggccacgacatgccgtggacgctgatccgcgccgcctgcatgagcatcgcc
gacaccgcgatccatccgctgcaggacgtgctctgcctgggcggcgaacaccgcatgaac
cgccccggcgccgacgacggctgctggcgctggcgtttccagtggaacgacgtgcacccc
tggcacgggcgccggctggccgagttctgccgcctctacggccgcacgccggccgcttga

DBGET integrated database retrieval system