KEGG   Rubrivivax gelatinosus: RGE_32580Help
Entry
RGE_32580         CDS       T01803                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00260  Glycine, serine and threonine metabolism
rge00750  Vitamin B6 metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01230  Biosynthesis of amino acids
Module
rge_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_32580 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RGE_32580 (thrC)
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RGE_32580 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAL96597
UniProt: I0HUB0
Position
complement(3477189..3478607)
Genome map
AA seq 472 aa AA seqDB search
MKYLSTRGDATLRGFSDILLEGLAPDGGLYLPTHYPQVDAATLARWRGLSYADLAFEILS
LYIDDIPAADLKRLVHATYTEAVFGTPEITPLKPLGDGLALQALSNGPTLAFKDMAMQLL
GNLFEYELGRRGETLNILGATSGDTGSAAEYAMRGKTGVNVFMLSPHGRMSPFQQAQMFS
LQDANIHNLAVEGVFDDCQDIVKAVSNDLEFKRRHKIGTVNSINWARLLAQVVYYFAGYF
QATKTNDERVSFAVPSGNFGNICAGHVARSMGLPIHRLVLATNENDVLDEFFRTGTYRVR
GSAETFETSSPSMDISKASNFERFVFDLLGRDAARTRELFGAGVSQQGGFTLTAEEHARC
AGFGFVSGRSTHADRLATIAATWRETGVLVDTHTADGLKVAREHRDAGVPMIVLETALPA
KFAATITEALGADAPVPPRPAALAGLEALPRRFTVVPPDAAAVKAFIEAHAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacctcagcacccgcggcgacgccacgctgcgcggcttctccgacatcctgctc
gaaggcctggcgcccgacggcggcctgtacctgccgacgcactacccgcaggtcgacgcc
gcgacgctcgcgcgctggcgcgggctgtcctatgccgacctggcgttcgagatcctgtcg
ctctatatcgacgacatcccggccgccgacctgaagcggctggtgcacgccacctacacc
gaggccgtcttcggcacgcccgagatcacgccgctgaagccgctgggcgatggcctcgcc
ctgcaagccctgtccaacggcccgacgctggccttcaaggacatggcgatgcagctgctg
ggcaacctgttcgagtacgaactgggccgccgcggcgagacgctgaacatcctcggcgcc
acctccggcgacaccggcagcgccgccgaatacgcgatgcgcggcaagacgggcgtcaac
gtcttcatgctgagcccccacggccgcatgagcccgttccagcaggcgcagatgttcagc
ctgcaggacgccaacatccacaacttggccgtcgaaggcgtgttcgacgactgccaggac
atcgtcaaggccgtcagcaacgacctcgagttcaagcgccgccacaagatcggcaccgtc
aactcgatcaactgggcgcggctgctggcccaggtcgtctactacttcgccggttatttc
caggcgacgaagacgaacgacgagcgcgtgtccttcgccgtgccctcgggcaacttcggc
aatatctgcgccggccacgtcgcgcgttcgatgggcctgccgattcaccgcctggtgctg
gcgaccaacgagaacgacgtgctcgacgagttcttccgcacggggacttatcgcgtgcgt
ggcagcgccgagaccttcgagacctcgtcgccgtcgatggacatcagcaaggcgagcaac
ttcgagcgttttgtcttcgacctgctgggccgcgacgcggcgcgcacgcgcgaactgttc
ggtgccggcgtctcgcagcagggcggcttcacgctgactgccgaggagcacgcgcgctgc
gccggcttcggcttcgtctcgggccgcagcacgcatgccgaccgcctggcgacgatcgcc
gccacctggcgcgaaaccggcgtgctcgtcgacacccacaccgccgacggcctgaaggtc
gcacgcgagcaccgcgacgccggcgtgccgatgatcgtgctggagaccgcgctgccggcc
aagttcgccgcgacgatcaccgaggcgctgggcgccgacgcaccggtgccgccgcgcccg
gcggcgctggccgggctcgaggcgctgccgcgccgcttcaccgtcgtgccgcccgacgcg
gcggcggtcaaggccttcatcgaggcccacgccggatga

DBGET integrated database retrieval system