KEGG   Rubrivivax gelatinosus: RGE_32580Help
Entry
RGE_32580         CDS       T01803                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_32580 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_32580 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RGE_32580 (thrC)
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RGE_32580 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3477189..3478607)
Genome map
AA seq 472 aa AA seqDB search
MKYLSTRGDATLRGFSDILLEGLAPDGGLYLPTHYPQVDAATLARWRGLSYADLAFEILS
LYIDDIPAADLKRLVHATYTEAVFGTPEITPLKPLGDGLALQALSNGPTLAFKDMAMQLL
GNLFEYELGRRGETLNILGATSGDTGSAAEYAMRGKTGVNVFMLSPHGRMSPFQQAQMFS
LQDANIHNLAVEGVFDDCQDIVKAVSNDLEFKRRHKIGTVNSINWARLLAQVVYYFAGYF
QATKTNDERVSFAVPSGNFGNICAGHVARSMGLPIHRLVLATNENDVLDEFFRTGTYRVR
GSAETFETSSPSMDISKASNFERFVFDLLGRDAARTRELFGAGVSQQGGFTLTAEEHARC
AGFGFVSGRSTHADRLATIAATWRETGVLVDTHTADGLKVAREHRDAGVPMIVLETALPA
KFAATITEALGADAPVPPRPAALAGLEALPRRFTVVPPDAAAVKAFIEAHAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacctcagcacccgcggcgacgccacgctgcgcggcttctccgacatcctgctc
gaaggcctggcgcccgacggcggcctgtacctgccgacgcactacccgcaggtcgacgcc
gcgacgctcgcgcgctggcgcgggctgtcctatgccgacctggcgttcgagatcctgtcg
ctctatatcgacgacatcccggccgccgacctgaagcggctggtgcacgccacctacacc
gaggccgtcttcggcacgcccgagatcacgccgctgaagccgctgggcgatggcctcgcc
ctgcaagccctgtccaacggcccgacgctggccttcaaggacatggcgatgcagctgctg
ggcaacctgttcgagtacgaactgggccgccgcggcgagacgctgaacatcctcggcgcc
acctccggcgacaccggcagcgccgccgaatacgcgatgcgcggcaagacgggcgtcaac
gtcttcatgctgagcccccacggccgcatgagcccgttccagcaggcgcagatgttcagc
ctgcaggacgccaacatccacaacttggccgtcgaaggcgtgttcgacgactgccaggac
atcgtcaaggccgtcagcaacgacctcgagttcaagcgccgccacaagatcggcaccgtc
aactcgatcaactgggcgcggctgctggcccaggtcgtctactacttcgccggttatttc
caggcgacgaagacgaacgacgagcgcgtgtccttcgccgtgccctcgggcaacttcggc
aatatctgcgccggccacgtcgcgcgttcgatgggcctgccgattcaccgcctggtgctg
gcgaccaacgagaacgacgtgctcgacgagttcttccgcacggggacttatcgcgtgcgt
ggcagcgccgagaccttcgagacctcgtcgccgtcgatggacatcagcaaggcgagcaac
ttcgagcgttttgtcttcgacctgctgggccgcgacgcggcgcgcacgcgcgaactgttc
ggtgccggcgtctcgcagcagggcggcttcacgctgactgccgaggagcacgcgcgctgc
gccggcttcggcttcgtctcgggccgcagcacgcatgccgaccgcctggcgacgatcgcc
gccacctggcgcgaaaccggcgtgctcgtcgacacccacaccgccgacggcctgaaggtc
gcacgcgagcaccgcgacgccggcgtgccgatgatcgtgctggagaccgcgctgccggcc
aagttcgccgcgacgatcaccgaggcgctgggcgccgacgcaccggtgccgccgcgcccg
gcggcgctggccgggctcgaggcgctgccgcgccgcttcaccgtcgtgccgcccgacgcg
gcggcggtcaaggccttcatcgaggcccacgccggatga

DBGET integrated database retrieval system