KEGG   Rubrivivax gelatinosus: RGE_32600Help
Entry
RGE_32600         CDS       T01803                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rge  Rubrivivax gelatinosus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RGE_32600
   01230 Biosynthesis of amino acids
    RGE_32600
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RGE_32600
   00290 Valine, leucine and isoleucine biosynthesis
    RGE_32600
Enzymes [BR:rge01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RGE_32600
    2.6.1.66  valine---pyruvate transaminase
     RGE_32600
Amino acid related enzymes [BR:rge01007]
 Aminotransferase (transaminase)
  Class I
   RGE_32600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3479961..3481193)
Genome map
AA seq 410 aa AA seqDB search
MKPIAKSSKLANVGYDIRGPVLDKARQMEEEGQRIIKLNIGNVAAFGLMPPDEIVRDMIH
NLPSQVAAGYTDSKGLFAPRKAVVHYTQEKRISGVTVDDVYLGNGASELIAMSMNALLDA
GDEVLIPSPDYPLHTAVVSLSGGTPVHYRCDEGSGWLPDLDDIRAKVSANTKAIVVINPN
NPTGALYPVDLLKDIVEIARQHQLIVFADEIYDKTLYDGNEHTSIASLADDVLFVTFNGL
SKNYRSCGYRSGWMVVSGEKRYAKDYIEGLNMLASMRLCANTPGQMAIQTALGGYQSIKD
LVAPGGRLLKQRDLAWEMMNAIPGVSVVKPKAALYMFPRLDPKVYPIADDQQFAYELLEQ
ERVLIVQGTGFNWPDPDHFRLVFLPNLDDLTEAIGRIERFLAGYRKRHSL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcccatcgccaagtccagcaagctcgccaacgtcggttacgacatccgcggtccg
gtgctcgacaaggcccggcagatggaggaggagggccagcgcatcatcaagctgaacatc
ggcaacgtcgccgccttcggcctgatgccccccgacgagatcgtccgggacatgatccac
aacctgccgtcgcaggtggccgccggctacaccgacagcaagggcctgttcgcgccgcgc
aaggcggtcgtgcactacacccaggaaaagcgcatctccggcgtgaccgtcgacgatgtc
tacctgggcaacggcgcctccgagctgatcgcgatgagcatgaacgccttgctcgacgcc
ggtgacgaggtgctgattccctcgcccgactacccgctgcacaccgcggtggtgtcgctg
tcgggcggcacgccggtgcactaccgctgcgacgaaggctcgggctggctgcccgacctc
gacgacatccgcgccaaggtgagcgccaacaccaaggccatcgtcgtcatcaacccgaac
aacccgacgggcgcgctctatccggtggacctgctgaaggacatcgtcgagatcgcgcgc
cagcaccagctgatcgtcttcgccgacgagatctacgacaagacgctgtacgacggcaac
gagcacaccagcatcgcctcgctggccgacgacgtgctcttcgtcaccttcaacggcctg
tccaagaactaccgctcctgcggctaccgctcgggctggatggtggtctccggcgagaag
cgctacgccaaggactacatcgagggcctgaacatgctggcctcgatgcggctgtgcgcc
aacacgcccggccagatggcgatccagaccgcgctcggcggctaccagagcatcaaggac
ctcgtcgccccgggcggccggctgctcaagcagcgcgacctcgcctgggagatgatgaac
gcgatccccggcgtcagcgtcgtcaagccgaaggcggcgctgtacatgttcccgcggctg
gaccccaaggtctacccgatcgccgacgaccagcagttcgcctacgagctgctggagcag
gagcgtgtgctgatcgtgcagggcaccggcttcaactggcccgaccccgaccacttccgc
ctcgtcttcctgcccaacctcgacgacctgaccgaggccatcgggcgcatcgagcgcttc
ctcgccggctatcgcaaacgccactccctttaa

DBGET integrated database retrieval system