KEGG   Rubrivivax gelatinosus: RGE_32600Help
Entry
RGE_32600         CDS       T01803                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00220  Arginine biosynthesis
rge00250  Alanine, aspartate and glutamate metabolism
rge00290  Valine, leucine and isoleucine biosynthesis
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
rge01210  2-Oxocarboxylic acid metabolism
rge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RGE_32600
   00290 Valine, leucine and isoleucine biosynthesis
    RGE_32600
   00220 Arginine biosynthesis
    RGE_32600
Enzymes [BR:rge01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RGE_32600
    2.6.1.66  valine---pyruvate transaminase
     RGE_32600
Amino acid related enzymes [BR:rge01007]
 Aminotransferase (transaminase)
  Class I
   RGE_32600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAL96599
UniProt: I0HUB2
Position
complement(3479961..3481193)
Genome map
AA seq 410 aa AA seqDB search
MKPIAKSSKLANVGYDIRGPVLDKARQMEEEGQRIIKLNIGNVAAFGLMPPDEIVRDMIH
NLPSQVAAGYTDSKGLFAPRKAVVHYTQEKRISGVTVDDVYLGNGASELIAMSMNALLDA
GDEVLIPSPDYPLHTAVVSLSGGTPVHYRCDEGSGWLPDLDDIRAKVSANTKAIVVINPN
NPTGALYPVDLLKDIVEIARQHQLIVFADEIYDKTLYDGNEHTSIASLADDVLFVTFNGL
SKNYRSCGYRSGWMVVSGEKRYAKDYIEGLNMLASMRLCANTPGQMAIQTALGGYQSIKD
LVAPGGRLLKQRDLAWEMMNAIPGVSVVKPKAALYMFPRLDPKVYPIADDQQFAYELLEQ
ERVLIVQGTGFNWPDPDHFRLVFLPNLDDLTEAIGRIERFLAGYRKRHSL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcccatcgccaagtccagcaagctcgccaacgtcggttacgacatccgcggtccg
gtgctcgacaaggcccggcagatggaggaggagggccagcgcatcatcaagctgaacatc
ggcaacgtcgccgccttcggcctgatgccccccgacgagatcgtccgggacatgatccac
aacctgccgtcgcaggtggccgccggctacaccgacagcaagggcctgttcgcgccgcgc
aaggcggtcgtgcactacacccaggaaaagcgcatctccggcgtgaccgtcgacgatgtc
tacctgggcaacggcgcctccgagctgatcgcgatgagcatgaacgccttgctcgacgcc
ggtgacgaggtgctgattccctcgcccgactacccgctgcacaccgcggtggtgtcgctg
tcgggcggcacgccggtgcactaccgctgcgacgaaggctcgggctggctgcccgacctc
gacgacatccgcgccaaggtgagcgccaacaccaaggccatcgtcgtcatcaacccgaac
aacccgacgggcgcgctctatccggtggacctgctgaaggacatcgtcgagatcgcgcgc
cagcaccagctgatcgtcttcgccgacgagatctacgacaagacgctgtacgacggcaac
gagcacaccagcatcgcctcgctggccgacgacgtgctcttcgtcaccttcaacggcctg
tccaagaactaccgctcctgcggctaccgctcgggctggatggtggtctccggcgagaag
cgctacgccaaggactacatcgagggcctgaacatgctggcctcgatgcggctgtgcgcc
aacacgcccggccagatggcgatccagaccgcgctcggcggctaccagagcatcaaggac
ctcgtcgccccgggcggccggctgctcaagcagcgcgacctcgcctgggagatgatgaac
gcgatccccggcgtcagcgtcgtcaagccgaaggcggcgctgtacatgttcccgcggctg
gaccccaaggtctacccgatcgccgacgaccagcagttcgcctacgagctgctggagcag
gagcgtgtgctgatcgtgcagggcaccggcttcaactggcccgaccccgaccacttccgc
ctcgtcttcctgcccaacctcgacgacctgaccgaggccatcgggcgcatcgagcgcttc
ctcgccggctatcgcaaacgccactccctttaa

DBGET integrated database retrieval system