KEGG   Rubrivivax gelatinosus: RGE_32980Help
Entry
RGE_32980         CDS       T01803                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rge  Rubrivivax gelatinosus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RGE_32980 (recR)
DNA repair and recombination proteins [BR:rge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RGE_32980 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3518675..3519262)
Genome map
AA seq 195 aa AA seqDB search
MADTALDALIEALRRLPGVGQKSAQRVAFHLLQHDRDGARRLAHALDVAAERVHHCARCH
TFTEDEVCPVCRDPERDARLLCVVETPADQHALERSGGYRGLYFVLMGRLSPLDGIGAGD
IGAAELIERASDGTVQEVILATSFTAEGEVTAHALAQALRSRGLKVTRLARGVPAGSEIE
YVDLGTIAHALVDRR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccgcgctcgacgcgctgatcgaggcgctgcggcggctgccgggcgtcggc
cagaagtcggcgcagcgcgtcgccttccacctgctgcagcacgaccgcgatggcgcgcgc
cgcctggcgcacgcgctggacgtcgcggccgagcgtgtgcaccactgcgcgcgctgccac
accttcaccgaagacgaggtctgcccggtctgccgcgaccccgagcgcgacgcccggctg
ctgtgcgtcgtcgagacgccggccgaccagcacgcgctggaacgcagcggcggctaccgc
ggcctgtacttcgtgctgatgggccggctgtcgccgctggacggcatcggcgccggcgac
atcggcgccgccgagctgatcgaacgcgcgagcgacggcaccgtgcaggaagtcatcctc
gccaccagcttcactgccgaaggcgaggtcaccgcgcacgcgctggcccaggcgctgcgt
tcccgcggcctgaaggtcacgcgcctggcgcgcggcgtgccggcgggcagcgaaatcgag
tacgtcgacctgggcacgatcgcccacgccttggtcgaccggcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system