KEGG   Rubrivivax gelatinosus: RGE_33220Help
Entry
RGE_33220         CDS       T01803                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rge  Rubrivivax gelatinosus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rge00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3544530..3545387)
Genome map
AA seq 285 aa AA seqDB search
MNDRPAAVWQTARFRIDLSRPQVMGIVNVTPDSFSDGGRYAELDAAKARCERLLEEGVDI
LDIGGESTRPGSRTPELAEETARVLPLVRHAVTLGVPVSVDTSTPELMRAVLDAGADIVN
DVRSLARPGAVDALAAHTTAGVCLMHMRGEPGTMQALTEYGDVVAEVAAFLRERVAVLEA
AGVARERITLDPGIGFAKTSEQNLELMARQHELLAEGLPLLLGWSRKSTLGKVTGRPVDE
RLVASVAAALMAVERGARIVRVHDVGATVDALKLWAAVAASRPSV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgccccgctgccgtctggcagaccgcccgtttccgcatcgacctgtcgcgt
ccgcaggtcatgggcatcgtcaacgtcacgcccgactcgttctccgacggcggccgctac
gccgagctcgacgccgccaaggcgcgctgcgagcggctgctggaagagggcgtcgacatc
ctggacatcggcggcgagtcgacacgcccgggctcgcgcacgcccgagctcgccgaggag
acggcgcgtgtgctgccgctggtgcgccacgcggtgacgctgggtgtgccggtgtcggtg
gacaccagcacgccggagctgatgcgcgccgtgctcgacgccggtgccgacatcgtcaac
gacgtgcgctcgctcgcccggcccggcgccgtcgacgcgctggccgcgcatacgacggcc
ggcgtctgcctgatgcacatgcgcggcgagcccggcacgatgcaggccctgaccgagtac
ggcgacgtcgtcgccgaggtcgccgccttcctgcgcgagcgggtcgccgtgctcgaagcc
gccggcgtcgcgcgcgagcgcatcacgctagacccgggcatcggtttcgccaagacctcc
gagcagaacctcgagctgatggcgcgccagcacgagttgcttgccgaaggcctgccgctg
ctgctgggctggtcgcgcaagtcgacgctgggcaaggtcaccggccgtccggtcgacgag
cgcctggtcgccagcgtcgcggcggcgctgatggccgtcgaacgcggtgcgcgcatcgtg
cgcgtgcacgacgtcggcgccaccgtcgacgcgctcaagctctgggcggcggtcgccgct
tcccgcccgtccgtctga

DBGET integrated database retrieval system