KEGG   Rubrivivax gelatinosus: RGE_33980Help
Entry
RGE_33980         CDS       T01803                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rge  Rubrivivax gelatinosus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RGE_33980 (galU)
   00052 Galactose metabolism
    RGE_33980 (galU)
   00500 Starch and sucrose metabolism
    RGE_33980 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RGE_33980 (galU)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RGE_33980 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633668..3634585
Genome map
AA seq 305 aa AA seqDB search
MESRARMKSNQLILCNKMLVKKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEE
AYAAGVREMIFVTGRHKRPIEDHFDMTFELEVALEQANKKELLDVVHSVKPDDMECIYVR
QAQALGLGHAVLCGRRLVGNEPFAVLLADDLMVGEPPVLKQMVQQFDEWRASILAVQEVP
QEQTRRYGIVDGTPVNDRLMDVTRIVEKPAPAEAPSRLGVAGRYILTPGVFHEIMSQPRG
VGGEIQLTDGIASLLRREKVFAYRYEGKRFDCGSKEGFLQANVELALAHPELGPGFREYL
RGLEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcgtgccagaatgaaatcgaatcaactcattctatgtaacaaaatgttggtc
aagaaggcaatattcccggtcgccggtctcggcacgcggttcctgcccgcgaccaaggcg
cagcccaaggaaatgctgccggtcgtcgacaagccgctgatccagtacgccgtcgaggag
gcttacgccgccggcgtgcgcgagatgatcttcgtcaccggccgccacaagcgcccgatc
gaagaccacttcgacatgaccttcgagctcgaggtcgcgctcgagcaggcgaacaagaag
gaactgctggacgtcgtgcacagcgtcaagcccgacgacatggagtgcatctacgtgcgc
caggcgcaggcgctgggcctgggccacgcggtgctgtgcggacggcggctggtcggcaac
gaacccttcgcggtgctgctggccgacgacctgatggtcggcgagccgccggtgctcaag
cagatggtgcagcagttcgacgagtggcgcgcctcgatcctcgcggtgcaggaagtgccg
caggagcagacgcggcgctacggcatcgtcgacggcacgccggtcaacgaccgcctcatg
gacgtcacgcgcatcgtcgagaagccggcgccggccgaggcgccgtcgcggctgggcgtg
gccgggcgctacatcctgacgccgggcgtgttccacgagatcatgagccagccgcgcggc
gtcggcggcgagatccagctcaccgacggcatcgccagcctgctgcggcgcgagaaggtc
ttcgcctaccgctacgaaggcaagcgtttcgactgcggcagcaaggaaggtttcctgcag
gccaacgtcgaactcgcgctggcgcacccggagctgggccccggcttccgcgaatacctg
cgcggactggaactctga

DBGET integrated database retrieval system