KEGG   Rubrivivax gelatinosus: RGE_34180Help
Entry
RGE_34180         CDS       T01803                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rge01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rge01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3651681..3652904)
Genome map
AA seq 407 aa AA seqDB search
MTQLLTLHDALVDWLAYGLLGASWWQVVLFTLAVTHVTIAAVTIFLHRSQAHRALDLHPI
VSHFLRFWLWLTTGMVTKEWVAIHRKHHAKCETEEDPHSPVTRGIKTVLLTGSELYRAEA
KVGETLSKYGHGTPDDWIERHLYSRFTWQGVALMLIVDMLLFGALGATVWAVQMIWIPIH
AAGIINGLGHFWGYRNFEAADASTNISPWGVLIGGEELHNNHHTYPTSAKFSVKRYEFDI
GWAYIRGMQALGLAKVRKTPPRLALGEAKPVADGQTLDALIANRYEVMAGYAKEMRRAVR
AELAHLKAQGAQNSAHWRDLVLAKTWLHRDEDKIPHGVRPRLTQALGDNPSLAKLVAMRE
ELRALWTRTNVSAEQLVADLQAWCRKAEDSGIAALQEFSLKLRSARA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttgttgaccctccacgacgccctcgtcgattggctcgcctacgggctgctc
ggcgcgtcgtggtggcaggtcgtgcttttcacgctggcggtgacgcacgtgacgatcgcg
gcggtgacgatcttcctgcatcgctctcaggcgcatcgtgcgctcgacctgcacccgatc
gtctcgcacttcctccgcttctggctctggctgaccaccggcatggtgaccaaggagtgg
gtcgcgatccaccgcaaacaccacgcgaagtgcgagaccgaggaagacccgcacagcccg
gtgacgcgcggcatcaagaccgtgctgctgaccggcagcgagctctaccgcgccgaggcc
aaggtcggcgagacgctgtccaagtacggccacggcacgccggacgactggatcgagcgc
catctctacagccgcttcacctggcagggcgtggcgctgatgctgatcgtcgacatgctg
ctcttcggcgcgctgggcgcgaccgtctgggcggtgcagatgatctggatcccgatccac
gccgccggcatcatcaacggcctgggccacttctggggctaccgcaacttcgaggcggcc
gacgcctcgaccaacatctcgccctggggcgtgctgatcggtggcgaggaactgcacaac
aaccaccacacctacccgacctcggcgaagttctcggtcaagcgctacgagttcgacatc
ggctgggcctacatccgcggcatgcaggcgctggggctggcaaaggtgcgcaagacgccg
ccgcggctggcgctgggcgaagccaagccggtggccgacggccagacgctggacgcgctg
atcgccaaccgctacgaggtgatggcgggttatgccaaggaaatgcggcgtgcggtgcgc
gccgaactggcgcatctgaaagcgcagggcgcccaaaacagtgcgcactggcgcgatctg
gtgctcgccaagacctggctgcaccgcgacgaagacaagatcccgcacggcgtgcggccg
cgcctgacgcaggcgctgggcgacaacccgagtctggccaagctggtcgcgatgcgcgag
gagctgcgtgcgctgtggacgcgcaccaacgtctcggccgagcagctcgtcgccgacctg
caggcctggtgccgcaaggccgaggacagcggcatcgccgcgctgcaggagttctcgctg
aagctgcgttcggcgcgcgcctga

DBGET integrated database retrieval system