KEGG   Rubrivivax gelatinosus: RGE_35060Help
Entry
RGE_35060         CDS       T01803                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase Pcm (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rge  Rubrivivax gelatinosus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3749210..3749884
Genome map
AA seq 224 aa AA seqDB search
MNTELARFNMIEQQIRPWEVLDENVLSLLATVKREDFVPPALKSLAFADLQVPLITDEPN
GPVMLEPKIQAKLLQDLQVQRHEKVLEIGTGSGFMAALLAHRAQQVWTLECRPALVAQAR
ENLRRASVTTARVVEVTPEEGARGLPAEAPFDAIVLSGSVAEVPRALLEQLKVGGRLAAI
VGELPIMQARIYTRVGPEAWSEVDLFETVAPRLQGFAERSRFAF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaactcgcccgcttcaacatgatcgagcagcagatccgtccgtgggaagtg
ctcgacgagaacgtgctgtcgctgctggcgacggtcaagcgcgaggatttcgtgccgccg
gcgctgaagtcgctggctttcgccgacctgcaggtgccgctgatcaccgacgagcccaac
ggcccggtgatgctggagcccaagatccaggccaagctgctgcaggatctgcaggtgcag
cgccacgagaaggtgctcgagatcggcaccggctcgggtttcatggccgctctgctggcg
caccgcgcgcagcaggtgtggacgctggaatgccgccccgcgctggtcgcccaggcgcgc
gagaacctgcgccgggccagcgtgacgacggcgcgcgtcgtcgaggtgacgcccgaggaa
ggcgcacgcggcctgcccgccgaagcgccgttcgacgccatcgtgctgtcgggctcggtc
gccgaggtgccgcgcgcgctgctcgaacaactcaaggtcggcggccgcctggcggcgatc
gtcggcgaactgccgatcatgcaggcgcgcatctacacccgcgtcggccccgaggcctgg
tccgaggtcgacctgttcgagaccgtcgcgccgcggctgcagggcttcgccgaacgctcg
cgtttcgcgttctga

DBGET integrated database retrieval system