KEGG   Rubrivivax gelatinosus: RGE_35660Help
Entry
RGE_35660         CDS       T01803                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00230  Purine metabolism
rge01100  Metabolic pathways
Module
rge_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RGE_35660 (gmk)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RGE_35660 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase AAA_16 MMR_HSR1 ABC_tran AAA_22 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: BAL96905
UniProt: I0HV68
Position
3811377..3811997
Genome map
AA seq 206 aa AA seqDB search
METPGNLFVVAAPSGAGKSSLVKALLELDSHLSVSISHTTRKPRGQEQNGREYWFVPEPE
FRSMIERGDFFEWAQVHGNLYGTSRKAIEERLMRGEDVVLEIDYQGALQIKKLFAYAVLI
FILPPSWDELRQRLLRRGEDGAEVIEVRMQNARDEVAQARHFDYVIINQLFETALFDLKT
VVHSQRLKYVTQCRNRSQVFAALDLL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcccggcaacctcttcgtcgtcgccgcgcccagcggcgccggcaaatccagc
ctcgtcaaggccctgctcgagctcgactcgcacctgtcggtgtcgatctcgcacaccacg
cgcaagccgcgcggccaggagcagaacgggcgcgagtactggttcgtccccgagcccgag
ttccgctcgatgatcgagcgcggcgatttcttcgagtgggcgcaggtgcacggcaatctc
tacggcacctcgcgcaaggcgatcgaggagcggctgatgcgcggcgaggacgtcgtgctc
gagatcgactaccagggcgcgctgcagatcaagaagctcttcgcctacgcggtgctgatc
ttcatcctgccgccgagctgggacgaactgcgccagcgcctgctgcgccgcggcgaggac
ggcgccgaggtcatcgaggtgcgcatgcagaacgcacgcgacgaggtggcccaggcccgc
cacttcgactacgttataatcaaccagttgttcgagacggcgctcttcgacctcaagacg
gtcgtgcactcgcagcgcctcaagtacgtgacgcagtgccgcaaccgttcccaggtcttc
gccgcactcgacctgctctga

DBGET integrated database retrieval system