KEGG   Rubrivivax gelatinosus: RGE_37670Help
Entry
RGE_37670         CDS       T01803                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RGE_37670
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RGE_37670
Enzymes [BR:rge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RGE_37670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4026026..4026955
Genome map
AA seq 309 aa AA seqDB search
MSDPVRRVSLIGAPTDIGAGARGASMGPEAMRVANLQSTLESHGVEVLDRGNLAGPSNPW
QPPVEGYRHLDQVVAWNVAVHDAVHAELDQGRMPILLGGDHCLAIGSISAVARHCREAGK
RLRVLWLDAHADFNTSLLTPSGNIHGMPVACLCGHGPKELVEIGGQVPALNAKWVRQIGI
RSVDPGEKRFVHEVGLEVFDMRYIDEMGMRHTMELALATLDAGTHLHVSFDVDFLDPEIA
PGVGTTIPGGPTYREAQLCMEMIADTGRLASLDVMELNPALDVRNKTATLAVDLIESLFG
KSTLMRAPR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccccgtccgccgcgtcagcctgatcggcgcgcccaccgacatcggcgccggc
gcgcgtggcgccagcatgggccccgaggcgatgcgtgtcgccaacctgcagagcacgctg
gagtcgcacggcgtcgaggtgctggaccgcggcaacctcgccggcccgtccaacccctgg
cagccgccggtcgagggctaccgccacctcgaccaggtcgtcgcctggaacgtcgccgtg
cacgacgcggtgcacgccgaactcgaccagggccgcatgccgatcctgctcggcggcgac
cactgcctggcgatcggctcgatcagcgccgtggcgcgccactgccgcgaagccggcaag
cgcctgcgtgtgctctggctcgacgcccacgccgacttcaacaccagcctgctgacgccc
agcggcaacatccacggcatgccggtggcctgcctgtgcggccacggcccgaaggaactg
gtcgagatcggcggccaggtgccggcgctgaacgccaagtgggtgcgccagatcggcatc
cgcagcgtcgacccgggcgagaagcgcttcgtgcacgaggtcggactcgaggtcttcgac
atgcgctatatcgacgagatgggcatgcgccacacgatggagctggcgctggcgacgctg
gacgccggcacccatctgcacgtcagcttcgacgtcgacttcctcgatcccgagatcgcg
cccggcgtcggcacgacgatccccggcggcccgacctaccgcgaagcccagctctgcatg
gagatgatcgccgacaccggccgcctggccagcctcgacgtgatggagctgaacccggcg
ctggacgtgcgcaacaagaccgcgacgctggccgtcgacctgatcgagagcctgttcggc
aagagcacgctgatgcgcgcgccgcgctga

DBGET integrated database retrieval system