KEGG   Rubrivivax gelatinosus: RGE_37670Help
Entry
RGE_37670         CDS       T01803                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00220  Arginine biosynthesis
rge00330  Arginine and proline metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
rge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RGE_37670
   00330 Arginine and proline metabolism
    RGE_37670
Enzymes [BR:rge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RGE_37670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAL97106
UniProt: I0HVR9
Position
4026026..4026955
Genome map
AA seq 309 aa AA seqDB search
MSDPVRRVSLIGAPTDIGAGARGASMGPEAMRVANLQSTLESHGVEVLDRGNLAGPSNPW
QPPVEGYRHLDQVVAWNVAVHDAVHAELDQGRMPILLGGDHCLAIGSISAVARHCREAGK
RLRVLWLDAHADFNTSLLTPSGNIHGMPVACLCGHGPKELVEIGGQVPALNAKWVRQIGI
RSVDPGEKRFVHEVGLEVFDMRYIDEMGMRHTMELALATLDAGTHLHVSFDVDFLDPEIA
PGVGTTIPGGPTYREAQLCMEMIADTGRLASLDVMELNPALDVRNKTATLAVDLIESLFG
KSTLMRAPR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccccgtccgccgcgtcagcctgatcggcgcgcccaccgacatcggcgccggc
gcgcgtggcgccagcatgggccccgaggcgatgcgtgtcgccaacctgcagagcacgctg
gagtcgcacggcgtcgaggtgctggaccgcggcaacctcgccggcccgtccaacccctgg
cagccgccggtcgagggctaccgccacctcgaccaggtcgtcgcctggaacgtcgccgtg
cacgacgcggtgcacgccgaactcgaccagggccgcatgccgatcctgctcggcggcgac
cactgcctggcgatcggctcgatcagcgccgtggcgcgccactgccgcgaagccggcaag
cgcctgcgtgtgctctggctcgacgcccacgccgacttcaacaccagcctgctgacgccc
agcggcaacatccacggcatgccggtggcctgcctgtgcggccacggcccgaaggaactg
gtcgagatcggcggccaggtgccggcgctgaacgccaagtgggtgcgccagatcggcatc
cgcagcgtcgacccgggcgagaagcgcttcgtgcacgaggtcggactcgaggtcttcgac
atgcgctatatcgacgagatgggcatgcgccacacgatggagctggcgctggcgacgctg
gacgccggcacccatctgcacgtcagcttcgacgtcgacttcctcgatcccgagatcgcg
cccggcgtcggcacgacgatccccggcggcccgacctaccgcgaagcccagctctgcatg
gagatgatcgccgacaccggccgcctggccagcctcgacgtgatggagctgaacccggcg
ctggacgtgcgcaacaagaccgcgacgctggccgtcgacctgatcgagagcctgttcggc
aagagcacgctgatgcgcgcgccgcgctga

DBGET integrated database retrieval system