KEGG   Rubrivivax gelatinosus: RGE_40940Help
Entry
RGE_40940         CDS       T01803                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rge  Rubrivivax gelatinosus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rge00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rge00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4400914..4401963)
Genome map
AA seq 349 aa AA seqDB search
MSLHAPVVLDIAGTSLNDDDRRRIRHPLAGGLILFARNWADRRQLVELTAEIKSLREDLL
ICVDHEGGRVQRFRTDGFTHLPPMRAFGELWMDDAMRATAAATAAGYVLASELRACGVDF
SFTPVLDLDHGPSQVIGDRAFHRDARVAALLAKSLMHGLLQAGMASCGKHFPGHGFVKAD
SHLALPVDRRSLKAILGDDAQPYDWLAGSLQAVMPAHVVYPKVDALPAGFSRRWLQEILR
ERLGFDGAVFSDDLSMEGAKGVGSTLDAALLALGAGCDLVLLCNQSTVDGGAPVDALLEG
LEQAAADGRWTPDETSEARRTALLPQSEPLAWDELMRAPAYQRALERLP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttcatgcccccgtcgtgctggacatcgccggcacctcgctcaacgacgacgac
cgccgccgcatccgccatccgctggccggcggcctgatcctcttcgcacgcaactgggcc
gaccggcgccagctcgtcgagctgaccgccgagatcaagtcgctgcgcgaggacctgctg
atctgcgtcgaccacgaaggcgggcgcgtgcagcgtttccgcaccgacggcttcacccac
ctgccgccgatgcgcgccttcggcgagctgtggatggacgatgcgatgcgcgccaccgcg
gccgccaccgcggccggctacgtgctcgccagcgagctgcgcgcctgcggcgtcgacttc
agcttcacgccggtgctcgacctcgaccacggccccagccaggtgatcggcgaccgcgcc
ttccatcgcgacgcgcgtgtcgcggcgctgctggccaagagcctgatgcacggcctgctg
caggccggcatggcctcctgcggcaaacacttccccggccacggcttcgtcaaggccgac
tcgcacctcgcgctgccggtggaccggcgctcgctcaaggccatcctcggcgacgacgcc
cagccctacgactggctggccggcagcctgcaggcggtgatgccggcgcacgtggtctac
ccgaaggtggacgcgctgccggcgggtttctcgcggcgctggctgcaggagatcctgcgc
gagcgcctgggtttcgacggcgccgtcttcagcgacgacctcagcatggaaggcgccaag
ggcgtcggctcgacgctggacgcggcgctgctggcgctgggtgctggctgcgacctggtg
ctgctgtgcaaccagtcgacggtcgacggcggtgcgccggtcgacgcgctgctcgaaggc
ctggagcaggcggccgccgacggccgctggacgcccgacgagacctcggaggcgcggcgc
acggcgctgctgccgcagagcgagccgctggcctgggacgagctgatgcgcgcgccggcc
taccagcgcgcgctcgaacgcctgccctga

DBGET integrated database retrieval system