KEGG   Rubrivivax gelatinosus: RGE_41620Help
Entry
RGE_41620         CDS       T01803                                 

Gene name
paaG
Definition
enoyl-CoA hydratase/isomerase PaaG (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rge  Rubrivivax gelatinosus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RGE_41620 (paaG)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RGE_41620 (paaG)
   00650 Butanoate metabolism
    RGE_41620 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    RGE_41620 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGE_41620 (paaG)
   00310 Lysine degradation
    RGE_41620 (paaG)
   00360 Phenylalanine metabolism
    RGE_41620 (paaG)
   00380 Tryptophan metabolism
    RGE_41620 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RGE_41620 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RGE_41620 (paaG)
   00281 Geraniol degradation
    RGE_41620 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGE_41620 (paaG)
   00627 Aminobenzoate degradation
    RGE_41620 (paaG)
   00930 Caprolactam degradation
    RGE_41620 (paaG)
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RGE_41620 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4466924..4467718)
Genome map
AA seq 264 aa AA seqDB search
MTTPEPLVLTELRGDGERRTALLTLNRPKQLNALNDALMDQLGDALAAFDADDTVGCIVI
TGSERAFAAGADITAMAGFSFMDAYKGDFITRNWERILRVRKPVIAAVSGFALGGGCELA
MMCDFIIAADTAKFGQPEIKLGIIPGAGGTQRLPRAVGKAKAMDMILTARMMDAAEAERA
GLVSRIVPAAALLDEALAAAELINAQSGPSVMMAKECVNRAFESGLADGLGYERRLFHAL
FATEDQKEGMAAFVAKRKPAFKQR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccctgagcccctggtgctgaccgaactgcgcggcgacggcgaacgccgcacc
gcgctcctcacgctgaaccggcccaagcagctcaatgcgctgaacgacgcgctgatggac
cagctcggcgacgcgctcgccgccttcgacgccgacgacacggtcggctgcatcgtcatc
accggcagcgagagggccttcgccgccggcgccgacatcaccgcgatggccggcttcagc
ttcatggacgcctacaagggcgacttcatcacgcgcaactgggagcgcatcctgcgcgtc
aggaagccggtgatcgccgcggtctcgggcttcgcgctcggcggcggctgcgagctggcg
atgatgtgcgacttcatcatcgccgccgacacggcgaagttcggccagcccgagatcaag
ctcggcatcatccccggcgccggcggcacgcagcgtttgccgcgtgcggtcggcaaggcc
aaggcgatggacatgatcctgacggcccgcatgatggacgccgccgaggccgagcgtgcc
gggctggtgtcgcgcatcgtgccggcggccgcgctgctcgacgaggcgctggccgccgcc
gagctcatcaacgcccagagcgggcccagcgtgatgatggccaaggagtgcgtcaaccgc
gccttcgagtccggcctggccgacggcctgggctacgagcgccggctgttccacgcgctg
ttcgccaccgaggaccagaaggaaggcatggcagccttcgtcgccaagcgcaagccggcg
ttcaagcagcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system