KEGG   Rubrivivax gelatinosus: RGE_41950Help
Entry
RGE_41950         CDS       T01803                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rge  Rubrivivax gelatinosus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_41950 (gpmA)
   01230 Biosynthesis of amino acids
    RGE_41950 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGE_41950 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RGE_41950 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_41950 (gpmA)
Enzymes [BR:rge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RGE_41950 (gpmA)
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RGE_41950 (gpmA)
  Exosomal proteins of melanoma cells
   RGE_41950 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4497160..4497903
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVPLTETGVAQAREAGRLLKAAGYEFDVAYTSVLKR
AIWTLWHCLDEMERTWLPVVKDWRLNERHYGALQGLNKGDMAKQYGDQQVLIWRRSYDTP
PPVLDAADPRGQRQDPRYAKLAPEQVPLTECLKDTVARVLPCWNEVLAPAIKSGQRLVIA
AHGNSIRALVKYLDGISDADIVGLNIPNGIPLVYELDDELKPIRSYYLGDPEAAAKAAAA
VASQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctcgtcctgatccgtcacggggaatccacctggaacctcgagaaccgcttc
accggctggaccgacgtcccgctgaccgaaaccggcgtcgcccaggcgcgcgaagcgggc
cgtctgctgaaggccgccggctacgagttcgacgtcgcctacacctcggtgctgaagcgt
gccatctggacgctctggcactgcctggacgagatggagcgcacctggctgccggtcgtc
aaggactggcgcctgaacgaacgccactacggcgcgctgcaaggcctgaacaagggcgac
atggccaagcagtacggtgaccagcaggtgctgatctggcgccgcagctacgacacgccg
ccgccggtgctcgacgccgccgacccgcgtggccagcgccaggacccgcgttacgccaag
ctggcgcccgagcaggtgccgctgaccgagtgcctgaaggacaccgtcgcgcgcgtgctg
ccctgctggaacgaggtgctggccccggcgatcaagagcggccagcgcctggtcatcgcc
gcgcacggcaacagcatccgcgcgctggtgaagtatctggacggcatcagcgacgccgac
atcgtcggcctgaacatccccaacggcatcccgctggtctacgagctcgacgacgagctg
aagccgatccgcagctactacctcggcgaccccgaggccgcggccaaggccgccgccgcg
gtggcgagccagggcaaggcctga

DBGET integrated database retrieval system