KEGG   Rubrivivax gelatinosus: RGE_41970Help
Entry
RGE_41970         CDS       T01803                                 

Gene name
deoA
Definition
putative thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rge  Rubrivivax gelatinosus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RGE_41970 (deoA)
Enzymes [BR:rge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RGE_41970 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4498816..4500339)
Genome map
AA seq 507 aa AA seqDB search
MNRPTLAVRRLGIDTWRENVAFLHRDCPVVRAAGFQALSKVTIAAGGQSIAAVLNVVDDA
HLLEPLQLGLSEQAFARLGAADGDAVSIEHAAPPPSHAALRRKIAGERLGREDLHAVVAD
IAAERYTKVELAAFVVATQQYELDREEVLHLTEAMIAAGRRLDWNGSGGGRPIVDKHCIG
GVPGNRTSMLVVPIVAEHGLLCPKTSSRAITSPAGTADTMEVLAEVELAPERLKQIVHAV
NGCLAWGGTAALSPADDVLIAVERPLAIDSPGQMIASILSKKIAAGSTHLVLDIPVGPTA
KVHSEAAAQRLKRVFEFVAERLGLTLEVVLTDGRQPVGRGIGPVLEARDVMQVLRHDPQA
PQDLRAKAIRLAGRMIEFDPAVRGGDGERIATQILDSGRALARLEAIVDAQGRRAEPPPP
GPLVFDVPAPADGVVAGIDNLRLARIAGLSGAPQMAGAGLDLFVKLGDAVRRGEPLYRIH
ACVAADLGFARREALHDSAYAITGGAR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtccgaccctcgccgtacgccgtctcggcatcgacacctggcgcgagaacgtc
gccttcctgcaccgcgactgcccggtggtgcgcgccgccggtttccaggccctgtccaag
gtgacgatcgccgccggcggccagagcatcgccgcggtgctcaacgtcgtcgacgacgcg
cacctgctcgaaccgctgcagctcggcctgagcgaacaggctttcgcgcgcctgggtgcc
gccgacggcgacgccgtctcgatcgaacacgccgcgccgccgccgtcgcacgccgcgctg
cggcgcaagatcgccggcgagcgcctggggcgcgaggacctgcacgccgtcgtcgccgac
atcgccgccgagcgctacaccaaggtcgaactcgccgccttcgtcgtcgcgacgcagcag
tacgagctcgaccgcgaggaggtgctgcacctgaccgaggcgatgatcgccgccggccgg
cgcctggactggaacggcagcggtggcggccggccgatcgtcgacaagcactgcatcggc
ggcgtgccgggcaaccgcacgtcgatgctggtcgtgcccatcgtcgccgagcacggcctg
ctgtgccccaagacctcgtcgcgcgcgatcacctcgccggccggcaccgccgacacgatg
gaggtgctggccgaggtcgaactcgcgcccgagcggctcaagcagatcgtgcatgccgtc
aacggctgcctggcctggggcggcacggcggcgctgtcgccggccgacgacgtgctgatc
gccgtcgagcgcccgctggcgatcgactcgccggggcagatgatcgcctccatcctgtcc
aagaagatcgccgccggctcgacgcatctggtgctcgacatcccggtcgggccgacggcc
aaggtgcattccgaggccgcggcgcagcgcctgaagcgggtcttcgagttcgtcgccgag
cgcctggggctgacgctggaggtggtgctgaccgacggccgccagccggtcggccgcggc
atcggcccggtgctcgaagcgcgcgacgtgatgcaggtgctgcgccacgacccgcaggcg
ccgcaggacctgcgtgccaaggcgatccgcctggccggccgcatgatcgagttcgacccc
gcggtgcgcggcggcgacggcgagcgcatcgccacgcagatcctcgactcgggccgcgcg
ctggcgcggctggaggccatcgtcgacgcccagggccggcgcgccgagccgccgccgccg
gggccgctggtcttcgacgtgccggcgccggccgacggcgtcgtcgccggcatcgacaac
ctgcgcctggcgcgcatcgccgggctgtcgggtgcgccgcagatggccggcgccgggctg
gacctgttcgtcaagctcggcgacgcggtgcggcgcggcgagccgctgtaccgaatccac
gcctgcgtcgccgccgacctcggcttcgcacgccgcgaagcgctgcacgacagcgcctat
gccatcaccggaggcgcacgatga

DBGET integrated database retrieval system