KEGG   Rubrivivax gelatinosus: RGE_42520Help
Entry
RGE_42520         CDS       T01803                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00330  Arginine and proline metabolism
rge00332  Carbapenem biosynthesis
rge01100  Metabolic pathways
rge01130  Biosynthesis of antibiotics
rge01230  Biosynthesis of amino acids
Module
rge_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RGE_42520 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RGE_42520 (proB)
Enzymes [BR:rge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RGE_42520 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA YqfQ
Motif
Other DBs
NCBI-ProteinID: BAL97588
UniProt: I0HX51
Position
complement(4560687..4561805)
Genome map
AA seq 372 aa AA seqDB search
MSTVLASARRIVVKVGSSLVTNEGRGVDAEAIGNWSRQLAALARDGREVVMVSSGAIAEG
MKRLGWTTRPKELNELQAAAAVGQMGLAQMYETRLSEQGLRSAQVLLTHADLADRERYLN
ARSTLLTLLALGVVPVINENDTVVTDEIKFGDNDTLGALVANLIEADALVILTDQRGLYS
ADPRKDPEARFIDVATAGDPALEQMAGGAGSSIGRGGMITKVLAAKRAAGSGASTVIAWG
REPDVLLRLARGEAIGSALVAGTPKFAARKQWMIDHLQLRGAVVVDAGAALKLREDGKSL
LPIGVVEVQGEFARGDVIAVLAPGGEVIARGLANYSSAEARLISRHASSQIESLLGYAHE
PEMIHRTNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtcctcgcgtccgcccgccgcatcgtcgtcaaggtcggctccagcctcgtc
accaacgaaggccgaggcgtcgacgccgaggcgatcggcaactggtcgcggcagctcgcg
gcactggcgcgcgacggccgcgaggtcgtgatggtctccagcggcgcgatcgccgagggc
atgaagcgcctgggctggacgacgcgtcccaaggagctcaacgaactgcaggccgcggcc
gccgtcggccagatgggcctggcccagatgtacgagacgcggctgtcggagcagggcctg
cgcagcgcccaggtgctgctgacgcacgccgacctggccgaccgcgagcgctacctcaac
gcgcgctcgacgctgctgacgctgctcgcgctgggcgtcgtgccggtgatcaacgagaac
gacaccgtcgtcaccgacgaaatcaagttcggcgacaacgacacgctgggcgcgctggtc
gccaacctgatcgaagccgatgcgctggtcatcctgaccgaccagcgcgggctgtactcg
gccgacccgcgcaaggatcccgaggcgcgcttcatcgacgtcgccaccgccggcgatccg
gcgctggagcagatggccggcggcgccggttcgagcatcggccgcggcggcatgatcacc
aaggtgctggccgccaaacgggcggccggcagcggtgcctccaccgtcatcgcctggggc
cgcgagcccgatgtgctgctgcgcctggcgcgcggcgaggcgatcggcagcgcgctggtc
gccggcacgcccaagttcgcggcacgcaagcagtggatgatcgaccacctgcagctgcgc
ggcgcggtcgtcgtcgacgccggcgcggcgctcaagctgcgcgaggacggcaagagcctg
ctgccgatcggcgtcgtcgaggtgcagggcgagttcgcgcgtggcgacgtcatcgcggtg
ctggcgcctggcggcgaggtgatcgcgcgcggcctggccaactactcgtcggccgaggcg
cggctgatctcgcgccatgcgtcctcgcagatcgaatcgctgctgggctacgcccacgag
cccgagatgatccaccggaccaacctggtcctggtctga

DBGET integrated database retrieval system