KEGG   Rubrivivax gelatinosus: RGE_44220Help
Entry
RGE_44220         CDS       T01803                                 

Gene name
rubA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rge  Rubrivivax gelatinosus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RGE_44220 (rubA)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RGE_44220 (rubA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4737191..4737769
Genome map
AA seq 192 aa AA seqDB search
MIGRLSGTLAEKNPPQLLVDVGGVGYEVDVPMSTFYHLPALGERVVLLTEFVVREDAQQL
FGFLTASERATFRLLVKISGVGPRMALALLSGLSVAELSQAVAAQDGARLVKVPGIGKKT
AERVLLELKGKLAPDLGLPSAAGGAGDAHADIVQALMALGYNEREAQAAAKALPKDVGVS
EGIKLALKALNR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgactctccggcacgctggccgaaaagaatcccccgcagctgctcgtcgac
gtcggcggcgtcggctacgaggtcgacgtgccgatgagcacgttctaccacctgcccgcg
ctcggcgagcgcgtcgtgctgctgaccgagttcgtcgtacgcgaggacgcgcagcagctc
ttcggctttctcacagcgagcgaacgcgcgaccttccggctgctggtcaagatcagcggc
gtcggcccgcgcatggcgctggcgctgctgtcggggctgtcggtggccgagctgtcgcag
gccgtcgcggcgcaggacggcgcgcgcctcgtcaaggtgccgggcatcggcaagaagacc
gccgaacgcgtgctgctggagttgaagggcaagctcgcgcccgacctgggcctgccctcg
gccgccggcggcgccggcgacgcccatgccgacatcgtgcaggcgctgatggcgctgggc
tacaacgagcgcgaggcgcaggcggcggccaaggcgctgcccaaggacgtcggggtcagc
gagggcatcaagctggccctgaaagccttgaaccgttag

DBGET integrated database retrieval system