KEGG   Rubrivivax gelatinosus: RGE_44650Help
Entry
RGE_44650         CDS       T01803                                 

Gene name
folE
Definition
GTP cyclohydrolase I FolE (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rge  Rubrivivax gelatinosus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RGE_44650 (folE)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RGE_44650 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4784467..4785216
Genome map
AA seq 249 aa AA seqDB search
MAKTVLPPEPATPRLLRSEDELATLPVSERIRYRLVCADKRFHANDNIADFVREGELPEL
KKEVQAKLEELLRALVIDTESDHNTQETAKRVAKMYIDEVFRGRFHPMPSVTEFPNAERL
NELMIVGPITVRSACSHHLCPIFGKVWIGLLPNEHSNLIGLSKYARITDWIMSRPQIQEE
AVTMLANELQERVRPDGLAIVMEADHFCMHWRGVKDTDSAMVNSVMRGAFLKDPNLRREF
LSLLPRKQD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtcctgcccccggagcccgcgacgccgcgcctgctgcgcagcgaggat
gaactggccacgctgccggtctccgaacgcatccgctaccgcctggtctgcgcggacaag
cgcttccacgccaacgacaacatcgccgacttcgtgcgcgagggcgaactgcccgagctg
aagaaggaggtgcaggccaagctcgaggagctgctgcgcgcgctggtcatcgacaccgag
agcgaccacaacacgcaggagacggccaagcgggtggccaagatgtacatcgacgaggtc
ttccgcggccgcttccacccgatgccgtcggtgaccgagttccccaacgccgagcgcctg
aacgagctgatgatcgtcggcccgatcaccgtgcgcagcgcctgcagccaccacctgtgc
ccgatcttcggcaaggtctggatcggcctgctgcccaacgagcacagcaacctgatcggg
ctgtccaagtacgcccgcatcaccgactggatcatgagccggccgcagatccaggaggag
gcggtgacgatgctcgccaacgaactgcaggagcgcgtgcgccccgacggcctggccatc
gtgatggaagccgaccacttctgcatgcactggcgcggcgtcaaggacaccgacagcgcg
atggtcaacagcgtgatgcgcggcgcgttcctgaaggatccgaacctgcggcgcgaattc
ctctcgctgctgccgcgcaagcaagactga

DBGET integrated database retrieval system