KEGG   Rubrivivax gelatinosus: RGE_45930Help
Entry
RGE_45930         CDS       T01803                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G GlcB (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rge  Rubrivivax gelatinosus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RGE_45930 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGE_45930 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_45930 (glcB)
Enzymes [BR:rge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RGE_45930 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4919499..4921688)
Genome map
AA seq 729 aa AA seqDB search
MRTTFHRLHVDTLLARFIEDQVLPGTGVEPAAFWAGFDAIVADLAPRNAALLAERDRLQT
ELDAWHTKHPGPIKNMAKYRAFLEKIGYLVPVPAKVKATTKNVDSELALQAGPQLVVPIT
NARYALNAANARWGSLYDALYGTDALPESDGATRAGAYNPVRGAKVVEYARYVLDRTVPL
AKGSHIDSTGYRVEGGQLVVTLKDGKTVALKKPAQFVGYQGEAGSPSSLLFVHHGLHLDL
RIDRGTTIGASDPAGVCDLVVEAALSTILDLEDSVAVVDGADKVLAYSNWLGILKGTLTE
QVTKAGKTFTRGLNPDRRYTGPNGEEVVLHGRSLLFVRNVGHLMTTPAVLFGDDEREIPE
GILDAVVTTAIALHDLQRHGANGIVNSRAGSIYIVKPKMHGPAEVAFASELFGRVEALLG
LPKATVKLGIMDEERRTSVNLKACIAAAADRVAFINTGFLDRTGDEMHTAMKAGAMLRKG
DMKASAWIQAYERQNVLVGLECGLRGKAQIGKGMWAMPDLMGAMLQQKIAHPLAGANTAW
VPSPTAATLHALHYHQVDVAKIQKTLEKTDVDAEREALLEGLLTVPVVKKAKWSEAEIQQ
ELDNNVQGILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLEHGVVDKA
RVRATFKRMAKVVDQQNAGDPAYRAMAGRAKESAAFQAACDLVFKGTKQPSGYTEPLLHA
WRLKVKAAA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgaccttccaccgactgcacgtcgacacgctgctggcccgcttcatcgaagac
caggtgctgcccggcaccggcgtcgagcccgccgccttctgggccggcttcgacgccatc
gtcgccgacctggcgccgaggaacgccgcgctgctggccgaacgcgaccggctgcagacc
gagctcgacgcctggcacaccaagcatccgggcccgatcaagaacatggccaagtaccgc
gccttcctcgagaagatcggctacctggtgccggtgccggccaaggtgaaggcgacgacg
aagaacgtcgacagcgagctcgcgctgcaggccggcccgcagctcgtcgtgccgatcacc
aacgcgcgctacgcgctcaacgccgccaacgcacgctggggttcgctgtacgacgcgctc
tacggcaccgacgcgctgcccgagagcgacggcgccacgcgcgccggcgcctacaacccc
gtgcgcggcgccaaggtcgtcgagtacgcgcgctacgtgctcgaccgcaccgtgccgctg
gccaagggctcgcacatcgactccaccggctaccgcgtcgaaggcggccagctcgtcgtg
acgctgaaggacggcaagacggtggcgctgaagaagccggcgcagttcgtcggttatcag
ggcgaggccggcagcccgtcgtcgctgctgttcgtgcaccacggcctgcacctggacctg
cgcatcgaccgcggcacgacgatcggcgcctccgacccggccggcgtctgcgacctcgtc
gtcgaggcggcgctgtcgaccatcctcgacctggaagactcggtggccgtcgtcgacggc
gccgacaaggtgctggcctactccaactggctgggcatcctgaagggcacgctgaccgag
caggtcaccaaggccggcaagaccttcacgcgcggcctgaaccccgaccgccgctacacc
ggcccgaacggcgaggaggtcgtgctgcacggccgctcgctgctcttcgtgcgcaacgtc
ggccacttgatgacgacgccggcggtgctgttcggcgacgacgagcgcgagatccccgaa
ggcatcctcgacgccgtcgtcacgacggcgatcgcgctgcacgacctgcagcgccatggc
gcgaacggcatcgtcaactcgcgcgccggctcgatctacatcgtcaagccgaagatgcac
ggcccggccgaggtggccttcgccagcgaactcttcggccgtgtcgaggcgctgctgggc
ctgcccaaggccaccgtcaagctcggcatcatggacgaggagcgccgcaccagcgtcaac
ctcaaggcctgcatcgccgctgccgccgaccgcgtggccttcatcaacaccggcttcctc
gaccgcaccggcgacgagatgcacaccgcgatgaaggccggcgcgatgctgcgcaagggc
gacatgaaggcgagcgcctggatccaggcctacgagcgccagaacgtgctcgtcgggctg
gagtgcggtctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctg
atgggcgcgatgctgcagcagaagatcgcccacccgctggccggcgccaacaccgcctgg
gtgcccagcccgaccgcggcgacgctgcacgcgctgcactaccaccaggtcgatgtcgcc
aagatccagaagacgctggagaagaccgacgtcgacgccgagcgcgaggccctgctcgaa
ggcctgctgacggtgccggtggtcaagaaggccaagtggagcgaggccgagatccagcag
gagctggacaacaacgtgcagggcatcctcggctacgtcgtgcgctgggtcgaccagggc
gtcggctgctccaaggtgcccgacatccacgacgtcggcctgatggaagaccgcgcgacg
ctgcgcatctccagccagcacatcgccaactggctggagcacggcgtcgtcgacaaggcc
cgtgtgcgcgccaccttcaagcgtatggccaaggtcgtcgaccagcagaacgccggcgac
ccggcctaccgcgcgatggccggccgcgccaaggagagcgccgccttccaggctgcctgc
gatctggtcttcaagggcaccaagcagccctccggctacaccgagccgctgctgcacgcc
tggcggctgaaggtgaaggccgcggcctga

DBGET integrated database retrieval system