KEGG   Rubrivivax gelatinosus: RGE_46370Help
Entry
RGE_46370         CDS       T01803                                 

Definition
(GenBank) methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge02020  Two-component system
rge02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rge00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RGE_46370
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RGE_46370
Enzymes [BR:rge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RGE_46370
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RGE_46370
Two-component system [BR:rge02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RGE_46370
Bacterial motility proteins [BR:rge02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RGE_46370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 CheR_N PAS_4 IncA CENP-F_leu_zip PAS_8 DUF4201 PAS OmpH Spc7 IFT57 V_ATPase_I NRBF2 LETM1 KxDL Jnk-SapK_ap_N DUF4795 Fez1 DUF3584 HOOK TMF_TATA_bd HMMR_N ZapB APG6 Laminin_II Mnd1 Mod_r Ax_dynein_light 5_nucleotid Sec8_exocyst Fmp27_WPPW ADIP
Motif
Other DBs
NCBI-ProteinID: BAL97970
UniProt: I0HY83
Position
4964369..4967377
Genome map
AA seq 1002 aa AA seqDB search
MAGKSQEQAPARAESDAEELEIAPPAPALLLPPDEPFAGRVVAIGASAGGLDALARVFKA
LPPDTGAAFVVIQHLSPDHKSMMADLLGRYTEMPVCVAEHDMALAANRVHLIPPGKMMRV
AGDRLQLAPKPEHGLTLPIDTFFGSLAEQFADRAVAVVLSGTGSDGSRGVQEINAAGGIF
YVQDPTTAKFDGMPLSASQAAHYDFMGSAEALAAQLTTQLVSPRAEGTRLLSPHAPAVAQ
PLDAIHEILLHSSGIDFRQYKPTTVLRRIERRMQVLHCSSLLDYRERLAGSPDEQVLLRR
ELLIPVTRFFRDSEVYDLLAEQVIPELVTRAGPEGIRAWVACCATGEEAYSIAILFAEAF
RAAGRTRPVKIFATDVEQQYLDHAAAGLYPDTIAAEVSPERLSQFFIERQGRYQVQPELR
QMIIFARHNVIADPPFTRMNLVTCRNALIYLEPAAQESALRRLQYAMAPGAHLMLGPSES
LGELQRDFQPLKARSKVYRLLRRDRSAATMDMRGLHHTRLGDPAKRGSGLPPLMPRPGND
GALALLMQHYAPPSVVVSEARQLMRVYGDTRQLLQFAEGQATLDLMKLLPRDLVPVASML
LQGICTERSPQRSAPIRLPDGDGWCRVQLVARPLDGSDDGGFAMLSLETLPERGAATEPD
GTPVPADPPDDRYLRRIEELERDLAVMHDNLQATIEELETSNEELQATNEELMASNEELQ
STNEELQSVNEELYTVNSEYQEKVDVLNSVNADLENVSKAAAIPTVFVDEQLRLTRFTPE
ATPLFHLRQGDEGRSIEDFAHRLDYPSLFADLRLTLERGSVTEREVRSRSGQWWLARIQP
YPGRSPGASRAVMTFVNIDSVKDSERLQAVIDSLPQHVAVVDLHGAITRVNEAWRRFATE
NGDPAERRTGPGSNYLRVCAEAALSDADARRAHEGLTAVLEGRIPMFQMHYPCHAPDQKR
WFLMYAAPIRHSAGGAVVSHVDISEWVRLSGGSLPDGSKANA
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggaaagagccaagaacaagcaccggcgcgggccgagtccgacgccgaagagctg
gagattgcgccgcccgcgccggccctcctgctgccgcccgatgagccgttcgccggacgc
gtggtcgccatcggcgcctccgccggcggcctggacgcgctggcccgcgtcttcaaggcc
ctgccgccggacaccggcgcggccttcgtcgtgatccagcacctgtcgccggaccacaag
agcatgatggccgacctgctcggtcgctacaccgagatgccggtgtgcgtggccgagcac
gacatggcgctggccgccaaccgcgtgcacctgatcccgccgggcaagatgatgcgcgtg
gccggcgaccggctgcagctcgcacccaagcccgaacacgggctgacgctgccgatcgac
accttcttcggcagcctggccgagcagttcgccgaccgggcggtggccgtcgtgctctcg
ggcaccggctccgacggttcgcgcggcgtgcaggagatcaacgccgccggcggcatcttc
tacgtccaggacccgacgacggccaagttcgacggcatgccgctgtcggccagccaggcc
gcgcactacgacttcatgggcagcgccgaggcgctggccgcgcagctgacgacgcagctc
gtctcgccgcgcgccgagggcacgcggctgctgtcgccgcacgcgccggcggtggcccag
ccgctggacgcgatccacgagatcctgctgcattccagcggcatcgacttccgtcagtac
aagccgacgacggtgctgcggcgcatcgagcgccgcatgcaggtgctgcactgcagctcg
ctgctcgattaccgcgagcgcctggccggctcgcccgacgagcaggtgctgctgcgccgc
gagctgctgatcccggtgacgcgcttcttccgcgacagcgaggtctacgacctgctcgcc
gagcaggtgatccccgaactcgtcacccgcgccggcccggaaggcatccgcgcctgggtg
gcctgctgcgccaccggcgaggaggcgtactcgatcgcgatcctcttcgccgaggccttc
cgcgccgccgggcgcacgcggccggtgaagatcttcgccaccgacgtcgagcagcagtac
ctggaccacgccgccgccggcctgtacccggacacgatcgccgccgaggtctcgcccgag
cggctgtcgcagttcttcatcgagcgccagggccgctaccaggtgcagcccgagctgcgc
cagatgatcatcttcgcgcgccacaacgtcatcgccgacccgccgttcacgcgcatgaac
ctggtcacctgccgcaacgcgctgatctacctggagccggcggcgcaggaaagcgcgctg
cgccggctgcagtacgcgatggcgccgggcgcgcacctgatgctcggccccagcgagtcg
ctgggcgagctgcagcgcgacttccagccgctgaaggcgcgcagcaaggtctaccgcctg
ctgcgccgcgaccgctcggccgcgacgatggacatgcgcggcctgcaccacacgcgcctg
ggtgacccggccaaacgcggctcgggcctgccgccgctgatgccgcgccccggcaacgac
ggcgcgctggcgctgctgatgcagcactacgcgccgccgtcggtggtcgtcagcgaggcc
cgccagctgatgcgcgtctacggcgacacgcgccagctgctgcagttcgccgaaggccag
gcgacgctggacctgatgaagctgctgccgcgcgacctggtgccggtggccagcatgctg
ctgcagggcatctgcaccgaacgttcgccgcagcgctcggcgccgatccgcctgcccgac
ggcgacggctggtgccgcgtgcagctcgtcgcccggccgctggacggcagcgacgacggc
ggcttcgcgatgctgtcgctggagacgctgcccgagcgcggcgcggccaccgagcccgac
ggcacgccggtgccggccgatccgcccgacgatcgctacctgcgccgcatcgaggagctc
gagcgcgacctggcggtgatgcacgacaacctgcaggcgacgatcgaggagctcgagacc
tccaacgaggagctgcaggcgaccaacgaagagctgatggcctccaacgaggagctgcag
agcaccaacgaggagctgcagtccgtcaacgaggagctctacaccgtcaactccgagtac
caggagaaggtcgacgtcctgaactcggtcaacgccgacctggagaacgtctccaaggcg
gcggcgatcccgaccgtgttcgtcgacgagcagctgcgcctgacgcgcttcacgcccgag
gcgacgccgctgttccacctgcgccagggcgacgaaggccgctcgatcgaggacttcgcc
caccggctggactatccctcgctgttcgccgacctgcgcctgacgctggaacgcggcagc
gtcaccgagcgcgaggtgcgcagccgcagcggccagtggtggctggcgcgcatccagccc
tacccgggccgctcgccgggcgccagccgcgcggtgatgaccttcgtgaacatcgactcg
gtcaaggactccgagcgcctgcaggccgtcatcgactcgctgccgcagcacgtcgccgtc
gtcgacctgcacggcgcgatcacgcgcgtcaacgaggcctggcgccgcttcgccaccgag
aacggcgacccggcggagcgccgcaccgggccgggcagcaactacctgcgggtctgcgcc
gaggcggcgctgtcggatgccgacgcccgccgtgcccacgagggcctgaccgcggtcctc
gaaggccgcatcccgatgttccagatgcactatccctgtcacgcaccggaccagaagcgc
tggttcctgatgtacgcggccccgatccgccattcggcgggcggcgccgtcgtcagccac
gtcgacatcagcgagtgggtccgcttgagcgggggttcgctgcccgacggcagcaaggcg
aacgcatga

DBGET integrated database retrieval system