KEGG   Rubrivivax gelatinosus: RGE_46370Help
Entry
RGE_46370         CDS       T01803                                 

Definition
methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rge  Rubrivivax gelatinosus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rge02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rge02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4964369..4967377
Genome map
AA seq 1002 aa AA seqDB search
MAGKSQEQAPARAESDAEELEIAPPAPALLLPPDEPFAGRVVAIGASAGGLDALARVFKA
LPPDTGAAFVVIQHLSPDHKSMMADLLGRYTEMPVCVAEHDMALAANRVHLIPPGKMMRV
AGDRLQLAPKPEHGLTLPIDTFFGSLAEQFADRAVAVVLSGTGSDGSRGVQEINAAGGIF
YVQDPTTAKFDGMPLSASQAAHYDFMGSAEALAAQLTTQLVSPRAEGTRLLSPHAPAVAQ
PLDAIHEILLHSSGIDFRQYKPTTVLRRIERRMQVLHCSSLLDYRERLAGSPDEQVLLRR
ELLIPVTRFFRDSEVYDLLAEQVIPELVTRAGPEGIRAWVACCATGEEAYSIAILFAEAF
RAAGRTRPVKIFATDVEQQYLDHAAAGLYPDTIAAEVSPERLSQFFIERQGRYQVQPELR
QMIIFARHNVIADPPFTRMNLVTCRNALIYLEPAAQESALRRLQYAMAPGAHLMLGPSES
LGELQRDFQPLKARSKVYRLLRRDRSAATMDMRGLHHTRLGDPAKRGSGLPPLMPRPGND
GALALLMQHYAPPSVVVSEARQLMRVYGDTRQLLQFAEGQATLDLMKLLPRDLVPVASML
LQGICTERSPQRSAPIRLPDGDGWCRVQLVARPLDGSDDGGFAMLSLETLPERGAATEPD
GTPVPADPPDDRYLRRIEELERDLAVMHDNLQATIEELETSNEELQATNEELMASNEELQ
STNEELQSVNEELYTVNSEYQEKVDVLNSVNADLENVSKAAAIPTVFVDEQLRLTRFTPE
ATPLFHLRQGDEGRSIEDFAHRLDYPSLFADLRLTLERGSVTEREVRSRSGQWWLARIQP
YPGRSPGASRAVMTFVNIDSVKDSERLQAVIDSLPQHVAVVDLHGAITRVNEAWRRFATE
NGDPAERRTGPGSNYLRVCAEAALSDADARRAHEGLTAVLEGRIPMFQMHYPCHAPDQKR
WFLMYAAPIRHSAGGAVVSHVDISEWVRLSGGSLPDGSKANA
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggaaagagccaagaacaagcaccggcgcgggccgagtccgacgccgaagagctg
gagattgcgccgcccgcgccggccctcctgctgccgcccgatgagccgttcgccggacgc
gtggtcgccatcggcgcctccgccggcggcctggacgcgctggcccgcgtcttcaaggcc
ctgccgccggacaccggcgcggccttcgtcgtgatccagcacctgtcgccggaccacaag
agcatgatggccgacctgctcggtcgctacaccgagatgccggtgtgcgtggccgagcac
gacatggcgctggccgccaaccgcgtgcacctgatcccgccgggcaagatgatgcgcgtg
gccggcgaccggctgcagctcgcacccaagcccgaacacgggctgacgctgccgatcgac
accttcttcggcagcctggccgagcagttcgccgaccgggcggtggccgtcgtgctctcg
ggcaccggctccgacggttcgcgcggcgtgcaggagatcaacgccgccggcggcatcttc
tacgtccaggacccgacgacggccaagttcgacggcatgccgctgtcggccagccaggcc
gcgcactacgacttcatgggcagcgccgaggcgctggccgcgcagctgacgacgcagctc
gtctcgccgcgcgccgagggcacgcggctgctgtcgccgcacgcgccggcggtggcccag
ccgctggacgcgatccacgagatcctgctgcattccagcggcatcgacttccgtcagtac
aagccgacgacggtgctgcggcgcatcgagcgccgcatgcaggtgctgcactgcagctcg
ctgctcgattaccgcgagcgcctggccggctcgcccgacgagcaggtgctgctgcgccgc
gagctgctgatcccggtgacgcgcttcttccgcgacagcgaggtctacgacctgctcgcc
gagcaggtgatccccgaactcgtcacccgcgccggcccggaaggcatccgcgcctgggtg
gcctgctgcgccaccggcgaggaggcgtactcgatcgcgatcctcttcgccgaggccttc
cgcgccgccgggcgcacgcggccggtgaagatcttcgccaccgacgtcgagcagcagtac
ctggaccacgccgccgccggcctgtacccggacacgatcgccgccgaggtctcgcccgag
cggctgtcgcagttcttcatcgagcgccagggccgctaccaggtgcagcccgagctgcgc
cagatgatcatcttcgcgcgccacaacgtcatcgccgacccgccgttcacgcgcatgaac
ctggtcacctgccgcaacgcgctgatctacctggagccggcggcgcaggaaagcgcgctg
cgccggctgcagtacgcgatggcgccgggcgcgcacctgatgctcggccccagcgagtcg
ctgggcgagctgcagcgcgacttccagccgctgaaggcgcgcagcaaggtctaccgcctg
ctgcgccgcgaccgctcggccgcgacgatggacatgcgcggcctgcaccacacgcgcctg
ggtgacccggccaaacgcggctcgggcctgccgccgctgatgccgcgccccggcaacgac
ggcgcgctggcgctgctgatgcagcactacgcgccgccgtcggtggtcgtcagcgaggcc
cgccagctgatgcgcgtctacggcgacacgcgccagctgctgcagttcgccgaaggccag
gcgacgctggacctgatgaagctgctgccgcgcgacctggtgccggtggccagcatgctg
ctgcagggcatctgcaccgaacgttcgccgcagcgctcggcgccgatccgcctgcccgac
ggcgacggctggtgccgcgtgcagctcgtcgcccggccgctggacggcagcgacgacggc
ggcttcgcgatgctgtcgctggagacgctgcccgagcgcggcgcggccaccgagcccgac
ggcacgccggtgccggccgatccgcccgacgatcgctacctgcgccgcatcgaggagctc
gagcgcgacctggcggtgatgcacgacaacctgcaggcgacgatcgaggagctcgagacc
tccaacgaggagctgcaggcgaccaacgaagagctgatggcctccaacgaggagctgcag
agcaccaacgaggagctgcagtccgtcaacgaggagctctacaccgtcaactccgagtac
caggagaaggtcgacgtcctgaactcggtcaacgccgacctggagaacgtctccaaggcg
gcggcgatcccgaccgtgttcgtcgacgagcagctgcgcctgacgcgcttcacgcccgag
gcgacgccgctgttccacctgcgccagggcgacgaaggccgctcgatcgaggacttcgcc
caccggctggactatccctcgctgttcgccgacctgcgcctgacgctggaacgcggcagc
gtcaccgagcgcgaggtgcgcagccgcagcggccagtggtggctggcgcgcatccagccc
tacccgggccgctcgccgggcgccagccgcgcggtgatgaccttcgtgaacatcgactcg
gtcaaggactccgagcgcctgcaggccgtcatcgactcgctgccgcagcacgtcgccgtc
gtcgacctgcacggcgcgatcacgcgcgtcaacgaggcctggcgccgcttcgccaccgag
aacggcgacccggcggagcgccgcaccgggccgggcagcaactacctgcgggtctgcgcc
gaggcggcgctgtcggatgccgacgcccgccgtgcccacgagggcctgaccgcggtcctc
gaaggccgcatcccgatgttccagatgcactatccctgtcacgcaccggaccagaagcgc
tggttcctgatgtacgcggccccgatccgccattcggcgggcggcgccgtcgtcagccac
gtcgacatcagcgagtgggtccgcttgagcgggggttcgctgcccgacggcagcaaggcg
aacgcatga

DBGET integrated database retrieval system