KEGG   Rhodococcus jostii: RHA1_ro00056Help
Entry
RHA1_ro00056      CDS       T00382                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro00056
   01230 Biosynthesis of amino acids
    RHA1_ro00056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro00056
   00030 Pentose phosphate pathway
    RHA1_ro00056
   00051 Fructose and mannose metabolism
    RHA1_ro00056
   00052 Galactose metabolism
    RHA1_ro00056
  Energy metabolism
   00680 Methane metabolism
    RHA1_ro00056
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RHA1_ro00056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62407..63360
Genome map
AA seq 317 aa AA seqDB search
MPDIVTLTMNPALDITTSTNRVVPTDKVRCGAPRRDPGGGGLNVARVLHVLGTPATAVFP
SGGHTGRALEDLVATEGVEIRSLTIRGSTRESLTINENETGLQYRFVLPGPTVTAREQVA
CLDLVIEVASGADYVVVSGSLPPGVPADFYQQVADVVGDLGARVIVDTSGPALRQLRGGV
FLVKPSIRELRDWTGRELSAIDDQVAAAREVIDRGVSQIVVLSLGADGALLVTRDRDEHF
PSVQVPVVSGVGAGDSMVAGVVCGLAHGRSLSDSVRYGIAAGAAMLQTPGTALCRRPDVE
RFYQLLTDGSAAGTIVG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacatcgtgacgttgacgatgaatcctgcgctcgacatcaccacgagcacgaac
cgggtggtgccgaccgacaaggtgcgctgcggcgcgcctcgccgagatcccggcggcggc
ggactgaacgtggcccgggtactgcacgttctcggaactcccgcgacggcggtgtttcct
tcgggcggccatacaggccgggccctcgaggatctcgtggccaccgagggcgtcgagatc
cggagtctgacgatccgcggttccacacgggagagcctgacgatcaacgagaacgagacg
ggtctgcagtaccgtttcgtcctgccgggaccaacagtgaccgcaagggaacaggtggcc
tgtctcgacctggtcatcgaggtcgcgtcgggcgccgactatgtggtggtgagcggaagt
ctgccaccgggtgtgcccgccgatttctaccagcaggtggcagacgtcgtcggcgacctc
ggtgcgcgagtcatcgtcgatacgtccggtccggccctgagacaacttcggggtggtgtg
tttctcgtcaaaccgagcattcgcgaactccgggactggacggggcgggagttgtcggcg
atcgacgaccaggtggcagcggctcgggaagtcatcgaccggggggtctcccagatcgtc
gtcctctcgctcggtgccgatggcgctctgctggtcacacgggaccgcgacgagcatttc
ccgtcggtccaagtcccggtggtcagcggtgtcggtgcaggcgacagcatggtcgccggt
gtggtgtgcggcctggcacacggtcgttcgttgagcgactcggtgcggtacgggatcgcc
gcgggggcggccatgctgcagacaccgggcaccgccctgtgccggcgacccgacgtcgag
cggttctatcaactgctcaccgacggatccgccgcgggcaccatcgtcggatag

DBGET integrated database retrieval system