KEGG   Rhodococcus jostii: RHA1_ro00325Help
Entry
RHA1_ro00325      CDS       T00382                                 

Gene name
adh1
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00071  Fatty acid degradation
rha00350  Tyrosine metabolism
rha00625  Chloroalkane and chloroalkene degradation
rha00626  Naphthalene degradation
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro00325 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro00325 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHA1_ro00325 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHA1_ro00325 (adh1)
   00626 Naphthalene degradation
    RHA1_ro00325 (adh1)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHA1_ro00325 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABG92161
UniProt: Q0SJX5
Position
394684..395697
Genome map
AA seq 337 aa AA seqDB search
MPTHQAVHVQAPGEPLTLVDVETGSPPRDHVRIAVSACGVCGTDHAFVNGAFPDMSWPLT
PGHEIAGTIAELGEGVDNYAVGDRVAVGWFGGHCNQCIPCRQGSFIHCEKLQVPSWQYPG
GYAESVIVPANALARIPNELSFAEAAPMSCAGVTTYDALRKTRAVPGDRVAILGIGGLGH
LGVQFARAMGFETIAIARGADKGDDARQLGAHHYIDSTAGDVSEALQALGGVSVVLGTAA
SSKAMGDVVGGLLPLGELTVVGVTPDPLPISPLQLITPGVDVTGHPSGTARDVEETMHFA
VLSGVRARIEEQPLARAAEAYAAMEEGRARYRMVLTM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccaacccatcaggcagttcacgtccaggcccccggcgaaccgctgacactcgtcgac
gtcgaaacagggtcgcccccgcgcgaccatgtacgcatcgcggtgtcggcgtgcggagtg
tgcggcaccgaccacgccttcgtcaacggcgcgttcccggacatgtcttggcctctgaca
cctggacacgagatcgccggaaccatcgccgaactcggtgagggcgtcgacaactacgcc
gtcggcgaccgcgtcgccgtgggttggttcggtgggcactgcaaccagtgcatcccctgt
cgtcagggctccttcattcattgcgagaagttgcaggtgccgagctggcagtatcccggc
ggatacgccgagtcggtgatcgttccagcaaacgcactggcccggattccgaacgagctg
tccttcgcggaagcagcacccatgagttgcgctggggtcaccacgtacgacgcgctgcgc
aaaaccagggccgtaccgggcgaccgcgtcgccatcctcggcatcggcggactcggccac
ctcggtgtgcagttcgcccgggcgatgggcttcgagacgatcgccatcgcccgcggcgcc
gacaaaggcgacgatgctcgtcagctcggcgcccaccactacatcgattccaccgccggc
gacgtcagcgaagcgttgcaggctctcggtggcgtatccgtggttctggggaccgcggcg
agttcgaaagcgatgggtgatgtggtcggtggactgcttccgctcggtgaactcacggtc
gtcggtgtcacgcccgacccactgccgatcagccccctacagctgatcactcccggcgtc
gatgtcaccggccacccgtccggcaccgcccgcgacgtcgaagagacgatgcacttcgcg
gtcctgtcaggcgtgcgcgcccgaatcgaggaacagcccctggctcgagcggcggaggcc
tacgccgcgatggaggaaggacgcgcacgctaccggatggtcctcacgatgtga

DBGET integrated database retrieval system