KEGG   Rhodococcus jostii: RHA1_ro00447Help
Entry
RHA1_ro00447      CDS       T00382                                 

Definition
alcohol dehydrogenase (EC:1.1.1.103)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
rha  Rhodococcus jostii
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro00447
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     RHA1_ro00447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529478..530503
Genome map
AA seq 341 aa AA seqDB search
MKAVQVVGYHTKLQLTDIPEPTIDGPLDVIVRIGGAGVCRTDLHILEGQWEAKSGVALPY
TIGHENSGWVHAVGDAVTNVTVGDKVILHPLITCGLCRACRSGDDVHCQNSTFPGIDVNG
GYAEYLRTTARSVVRIDDSLEPADVAALADAGLTAYHAVAKVAKTTRPGDVCVVIGAGGL
GHIGIQVLKAISGVTVVVLDRNPAAVELAVKIGADHGIVADGTHIQQVLDLTGGHGAEAV
VDFVGEGGATAEGIAMLRRAGNYYVVGYGENIDVPTIDVISTEINFIGNLVGSYNDLQEL
MTLAAQGKVTLHTTRYRLEDFQQALDDLDAGRVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcaagtggtgggataccacaccaaactgcagctcaccgacattcccgaa
cccacgatcgacggcccgctcgatgtcatcgtgcgcatcggcggcgcgggtgtgtgccgc
accgacctgcacatcctcgaagggcagtgggaggcgaagtccggtgtcgcgctgccgtac
acgatcggccacgagaactccggctgggtccacgccgtgggtgacgccgtcaccaacgtg
acggtcggcgacaaggtgattctgcacccgctcatcacgtgcggactgtgccgggcgtgc
cggtccggtgacgacgtgcactgccagaacagcacattccccggcatcgacgtcaacggc
gggtacgccgaatatctgcgcaccaccgcccgcagcgtggtccggatcgacgactcgctc
gaaccggccgacgtcgccgccctcgccgacgcgggcctgacggcgtaccacgccgttgcc
aaggtcgcgaagacgactcggcccggagacgtgtgcgtggtgatcggggccggcgggctc
ggtcacatcggcatccaggtcctgaaggcgatctccggcgtcaccgtggtcgtgctcgac
cgcaaccccgcggccgtcgaactcgccgtgaagatcggcgccgaccacggcatcgtcgcc
gacggcacccacatccagcaggtgctcgacctgaccggcggtcacggcgccgaggccgtc
gtcgacttcgtcggcgagggcggtgcgactgcagaagggatcgcgatgctgcgccgcgcc
gggaactactacgtcgtcgggtacggcgagaacatcgacgtcccgacgatcgatgtgatc
tccaccgagatcaacttcatcggaaatctcgtcggctcctacaacgacctccaggagctc
atgacccttgccgcccagggcaaggtcaccctgcacaccacccggtaccggctcgaggac
ttccagcaagcactcgacgatctcgatgccggccgggtgcgcggccgggcgattctcgtc
ccgtag

DBGET integrated database retrieval system