KEGG   Rhodococcus jostii: RHA1_ro00516Help
Entry
RHA1_ro00516      CDS       T00382                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rha  Rhodococcus jostii
Pathway
rha00360  Phenylalanine metabolism
rha00362  Benzoate degradation
rha00620  Pyruvate metabolism
rha00621  Dioxin degradation
rha00622  Xylene degradation
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Module
rha_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
rha_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro00516
   00650 Butanoate metabolism
    RHA1_ro00516
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RHA1_ro00516
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro00516
   00622 Xylene degradation
    RHA1_ro00516
   00621 Dioxin degradation
    RHA1_ro00516
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RHA1_ro00516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N NAD_binding_3 Pyr_redox CoA_binding
Motif
Other DBs
NCBI-ProteinID: ABG92352
UniProt: Q0SJD4
Position
complement(593863..594810)
Genome map
AA seq 315 aa AA seqDB search
MSTTKVAVIGSGNIGTDLVIKLEQVAKNVEIAVLVGIDPASDGLARARRLGISTVDTGVQ
GLIEHPEFDDIEIIFDSTSAKAHLTNAEALRPYGKHLIDLTPAAIGPYVVPAVNLDQHLG
APDVNMVTCGGQATIPIVAAISKVTDVHYAEIVASIASKSAGPGTRANIDEFTETTAKAI
EEVGGAAHGKAIIVLNPADPPLIMRDTVLALVSNPDQDAIRQSITDMVATVAAYVPGYRL
KQDVQFTELGGADTVATLTGGADIGSPVWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQ
VAEKLAERTALEIAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaaagtagcggtcatcggatccggaaacatcggaaccgacctggtcatc
aagctcgagcaggtcgcgaagaacgtcgagatcgccgtcctcgtcggcatcgacccggcc
tccgacggactcgcacgtgcccgccgcctgggcatcagcaccgtcgacaccggggtgcag
gggctgatcgagcaccccgagttcgacgacatcgaaatcatcttcgactccacctccgcc
aaggcgcacctgaccaacgcagaagcattgcgcccctacggcaagcacctgatcgatctc
acccccgccgcgatcggcccctacgtggtgcccgcggtcaacctcgaccagcacctgggt
gcccccgacgtgaacatggtgacctgcggcggccaggccaccatcccgatcgtggccgcg
atctccaaggtcaccgacgtgcactacgcagagatcgtcgcctcgatcgcgtcgaagtcc
gccggccccgggacccgcgcgaacatcgacgagttcaccgaaaccaccgcgaaggccatt
gaggaggtcggcggcgccgcgcacggcaaggcgatcatcgtcctcaaccccgccgacccg
ccgctgatcatgcgcgacaccgtcctcgccctggtcagcaaccccgaccaagacgcaatc
cgccagtcgatcaccgacatggtcgccacggtggccgcctacgtacccggctaccgactc
aagcaggacgtgcagttcaccgaactcggcggcgccgacacggtcgccaccctcaccggc
ggcgccgacatcggctcaccggtgtggaaggtatcggtgttcctcgaggtcgaaggcgcc
gcccactacctgcccgcctacgccggaaacctcgacatcatgacatccgcagcgctccag
gtcgccgaaaagctggccgagcgcacagcattggagatcgcacgatga

DBGET integrated database retrieval system